The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.1: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage integrase
Translate Function Assignments



Context on contig DQ530362 from base 94 to 6349 (6256 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1 1299 94 1206 -       1: 1   Phage integrase protein_id|ABF73226.1, gene_name|int, gi|104641918
2 1410 1589 180 + 110         Phage excisionase protein_id|ABF73227.1, gi|104641919
3 2501 1569 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Phage_integrases RamyA Phage integrase


  Protein Sequence

>fig|387910.2.peg.1 Phage integrase
MWFEKFKNKNNETKYRYYEKYKDPYTDKWKRVSVVLNKNTKQSQKEAMFRLEEKIKEKLN
NKSSSELKTLTFHALLDEWLEYHIKTSGFKVTTLDNLKTRIKNIKKNSSQNLLLNKIDTK
YMQTFINELSNVYSANQVKRQLGHMKEAIKYAVKFYNYPNEHILNSVTLPKKSKTIEDIE
KEEAKMYNYLEMEQVIQIRDFILNDNNMQYRARILVAGAVEVQALTGMRIGELLALQVKD
VDLKNKTIAINGTIHRIKCNAGFGHKDTTKTAGSKRKIAINSRIANVLKKIMLENKKMQQ
WEPSYVDRGFIFTTCQGNPMQGSRINKRLSSAAESLNINKKVTTHTLRHTHISLLAEMNI
SLKAIMKRVGHRDEKTTIKVYTHVTEKMDRELEQKLEKLVY

MD5 = cb9433e121fc29bace0efa24cea36767


  DNA Sequence

>fig|387910.2.peg.1 Phage integrase
atgtggtttgaaaaatttaaaaataagaacaatgaaacgaagtatagatactacgagaaa
tacaaagatccgtatacagataaatggaaacgtgtaagtgttgtcttgaataagaataca
aagcaatcgcaaaaagaggcaatgtttcgtttagaagaaaaaataaaagaaaaactaaac
aacaagtcgtcaagcgaattaaaaactttgacttttcacgcgttattagatgaatggctt
gaatatcatataaaaacatctggctttaaagtaacgacgcttgataatttgaaaacaaga
atcaaaaacatcaaaaagaacagttctcaaaatttacttttaaacaaaattgatacaaag
tacatgcaaacatttattaacgaattatcaaacgtatattctgcaaatcaggtaaagcgt
caacttggacatatgaaagaagctattaaatacgccgttaaattttacaattatccaaac
gaacacatattaaatagcgtcacactaccaaagaagagtaagacgatagaagatatagaa
aaagaagaagcgaaaatgtacaactatttagagatggaacaggtaatacagatacgcgat
tttatactgaacgataataacatgcagtatagagctcgtattttagttgctggggctgta
gaagttcaagctttaacaggtatgcgcataggtgagttattagctctccaagttaaagat
gttgacctcaaaaataaaacgatcgctattaatggcactattcacagaatcaaatgtaat
gctggatttggtcacaaagatactacgaagaccgcaggttcaaaaagaaaaatcgccatc
aattcaaggatagcaaatgtattgaaaaaaataatgttagaaaataaaaagatgcaacaa
tgggaaccaagctatgttgatagagggtttatattcacaacttgccaaggaaatcctatg
caaggcagtaggataaacaaacgattgtcctcagctgcagaatcattaaatataaataaa
aaagttactactcacacactaaggcatacacacataagtttattggcggaaatgaatata
tcgttaaaagcaattatgaaaagagtaggacatagagatgaaaaaacgactataaaggtg
tatacacatgtaacagagaaaatggacagagagttagagcaaaaattagaaaaacttgtg
tactaa


  DNA with Flanking Sequence

>fig|387910.2.peg.1 Phage integrase
actatgtacacaaaattattaggagaattaactaaagaaggtaaagtaaattatagaacc
aaaaaacgggtagaaattgcgtatagtatgagaaacataatcaaccattcacaagctggt
gcagtagccaaaggtgattgtgactttcttttaaacacactaaaagacattgttgatgaa
aacgaaaaaatattaagagaatataccaaatcaattaataagacggaataaataggtatc
cttgtattcagatttgatttttaacataatttgttcataaatttttaatttaagttcttg
ttcatcgtcataaatatcaaattcactactataattttcaactgattcttttatataagc
tatttctgcgtcagtaaattttacacacatttcatcacctactttttattttattatatc
acatttagtagctagtactaaaatcacgggtagcccgcctacccttattattttttgcca
attttgaggagggatgtaaaatgtggtttgaaaaatttaaaaataagaacaatgaaacga
agtatagatactacgagaaatacaaagatccgtatacagataaatggaaacgtgtaagtg
ttgtcttgaataagaatacaaagcaatcgcaaaaagaggcaatgtttcgtttagaagaaa
aaataaaagaaaaactaaacaacaagtcgtcaagcgaattaaaaactttgacttttcacg
cgttattagatgaatggcttgaatatcatataaaaacatctggctttaaagtaacgacgc
ttgataatttgaaaacaagaatcaaaaacatcaaaaagaacagttctcaaaatttacttt
taaacaaaattgatacaaagtacatgcaaacatttattaacgaattatcaaacgtatatt
ctgcaaatcaggtaaagcgtcaacttggacatatgaaagaagctattaaatacgccgtta
aattttacaattatccaaacgaacacatattaaatagcgtcacactaccaaagaagagta
agacgatagaagatatagaaaaagaagaagcgaaaatgtacaactatttagagatggaac
aggtaatacagatacgcgattttatactgaacgataataacatgcagtatagagctcgta
ttttagttgctggggctgtagaagttcaagctttaacaggtatgcgcataggtgagttat
tagctctccaagttaaagatgttgacctcaaaaataaaacgatcgctattaatggcacta
ttcacagaatcaaatgtaatgctggatttggtcacaaagatactacgaagaccgcaggtt
caaaaagaaaaatcgccatcaattcaaggatagcaaatgtattgaaaaaaataatgttag
aaaataaaaagatgcaacaatgggaaccaagctatgttgatagagggtttatattcacaa
cttgccaaggaaatcctatgcaaggcagtaggataaacaaacgattgtcctcagctgcag
aatcattaaatataaataaaaaagttactactcacacactaaggcatacacacataagtt
tattggcggaaatgaatatatcgttaaaagcaattatgaaaagagtaggacatagagatg
aaaaaacgactataaaggtgtatacacatgtaacagagaaaatggacagagagttagagc
aaaaattagaaaaacttgtgtactaaaaggtatctgccctttttctgcccttttttattt
ttaaagacgctacaaatcctttgtaacaactgatattaaaggctttttaacacaagtta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0006310       P:DNA recombination
GO:0015074       P:DNA integration
dbj|BAF66535.1 Staphylococcus aureus subsp. aureus str. Newman     integrase
fig|320843.3.peg.64 Bacteriophage ROSA FIG   Phage integrase
fig|359786.13.peg.349 Staphylococcus aureus subsp. aureus JH9 FIG   Phage integrase
fig|359786.3.peg.1031 Staphylococcus aureus subsp. aureus JH9 FIG   Phage integrase
fig|359787.11.peg.347 Staphylococcus aureus subsp. aureus JH1 FIG   Phage integrase
fig|359787.3.peg.2096 Staphylococcus aureus subsp. aureus JH1 FIG   Phage integrase
fig|426430.6.peg.264 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage integrase
fig|426430.8.peg.281 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage integrase
fig|553568.3.peg.955 Staphylococcus aureus A6224 FIG   Phage integrase
fig|553571.3.peg.2224 Staphylococcus aureus A6300 FIG   Phage integrase
gb|AAX91505.1 Bacteriophage ROSA     ORF009
gb|ABF73226.1 Staphylococcus aureus phage phiNM4     integrase
gb|ABQ48111.1 Staphylococcus aureus subsp. aureus JH9     phage integrase family protein
gb|ABR51173.1 Staphylococcus aureus subsp. aureus JH1     phage integrase family protein
gb|EEV77146.1 Staphylococcus aureus A6300     phage integrase
gb|EEV81157.1 Staphylococcus aureus A6224     phage integrase
gi|104641918 Staphylococcus aureus phage phiNM4 NCBI   integrase
gi|147739813 Staphylococcus aureus subsp. aureus JH9 NCBI   phage integrase family protein
gi|148266744 Staphylococcus aureus subsp. aureus JH9 NCBI   phage integrase family protein
gi|149945237 Staphylococcus aureus subsp. aureus JH1 NCBI   phage integrase family protein
gi|150373275 Staphylococcus aureus subsp. aureus str. Newman NCBI   integrase
gi|150392785 Staphylococcus aureus subsp. aureus JH1 NCBI   phage integrase family protein
gi|151220475 Staphylococcus aureus subsp. aureus str. Newman NCBI   integrase
gi|257854193 Staphylococcus aureus A6300 NCBI   phage integrase
gi|257858269 Staphylococcus aureus A6224 NCBI   phage integrase
gi|258447180 Staphylococcus aureus A6300 NCBI   phage integrase
gi|258448638 Staphylococcus aureus A6224 NCBI   phage integrase
gi|62636394 Bacteriophage ROSA NCBI   ORF009
gi|66395974 Staphylococcus phage ROSA NCBI   ORF009
img|638314754 Bacteriophage ROSA IMG   ORF009
img|639108339 Staphylococcus aureus aureus JH1 IMG   Phage integrase
img|640564634 Staphylococcus aureus aureus JH9 IMG   phage integrase family protein
img|640778381 Staphylococcus aureus aureus JH1 IMG   phage integrase family protein
img|640794623 Staphylococcus aureus aureus Newman IMG   integrase
kegg|sae:NWMN_0263 Staphylococcus aureus subsp. aureus Newman KEGG   integrase
kegg|sah:SaurJH1_0311 Staphylococcus aureus subsp. aureus JH1 KEGG   phage integrase family protein
kegg|saj:SaurJH9_0304 Staphylococcus aureus subsp. aureus JH9 KEGG   phage integrase family protein
ref|YP_001245687.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   phage integrase family protein
ref|YP_001315460.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   phage integrase family protein
ref|YP_001331297.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   integrase
ref|YP_240335.1 Staphylococcus phage ROSA RefSeq   ORF009
ref|ZP_05695330.1 Staphylococcus aureus A6300 RefSeq   phage integrase
ref|ZP_05696751.1 Staphylococcus aureus A6224 RefSeq   phage integrase
tr|A0EX17 Staphylococcus aureus phage phiNM4 TrEMBL   Integrase
tr|A5IPI8 Staphylococcus aureus (strain JH9) TrEMBL   Phage integrase family protein
tr|A6QDV3 Staphylococcus aureus (strain Newman) TrEMBL   Integrase
tr|A6TYA5 Staphylococcus aureus (strain JH1) TrEMBL   Phage integrase family protein
tr|Q4ZBP1 Staphylococcus phage ROSA TrEMBL   ORF009


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search