The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|370552.3.peg.1356: Streptococcus pyogenes MGAS10270

This feature in The SEED Viewer

NCBI Taxonomy Id: 370552

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_008022 from base 1286861 to 1298109 (11249 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1342 1287301 1286861 441 -       2: 2 5 ff Phage Holliday junction resolvase MGAS10270_Spy1342, YP_598951.1, gi|94990851, GeneID:4062566
1343 1287504 1287301 204 - -1     1: 1 ff Phage protein MGAS10270_Spy1343, YP_598952.1, gi|94990852, GeneID:4062567
1344 1287929 1287510 420 - 5 5 4: 1 8 9 7 ff
idu(2)
idu(2)
ilit(
8063092)
Single-stranded DNA-binding protein # phage-related ssb2, MGAS10270_Spy1344, YP_598953.1, gi|94990853, GeneID:4062568
1345 1288596 1287922 675 - -8 4   ff Phage single-strand DNA binding protein ssb1, MGAS10270_Spy1345, YP_598954.1, gi|94990854, GeneID:4062569
1346 1289079 1288597 483 - 0 4   ff Phage protein MGAS10270_Spy1346, YP_598955.1, gi|94990855, GeneID:4063763
1347 1289376 1289101 276 - 21 4   ff hypothetical protein - phage associated MGAS10270_Spy1347, YP_598956.1, gi|94990856, GeneID:4063764
1348 1289506 1289366 141 - -11       ff hypothetical protein MGAS10270_Spy1348, YP_598957.1, gi|94990857, GeneID:4063765
1349 1289736 1289503 234 - -4 4   ff hypothetical protein MGAS10270_Spy1349, YP_598958.1, gi|94990858, GeneID:4063766
1350 1290130 1289717 414 - -20 5   cwn
ff
DNA replication protein DnaD MGAS10270_Spy1350, YP_598959.1, gi|94990859, GeneID:4063767
1351 1290509 1290252 258 - 121       ff Phage replication protein MGAS10270_Spy1351, YP_598960.1, gi|94990860, GeneID:4063768
1352 1290788 1290603 186 - 93 4   ff Phage protein MGAS10270_Spy1352, YP_598961.1, gi|94990861, GeneID:4063769
1353 1291161 1290817 345 - 28       ff hypothetical protein MGAS10270_Spy1353, YP_598962.1, gi|94990862, GeneID:4063770
1354 1291574 1291320 255 - 158       ff hypothetical protein - phage associated MGAS10270_Spy1354, YP_598963.1, gi|94990863, GeneID:4063771
1355 1291909 1291760 150 - 185       ff hypothetical protein - phage associated MGAS10270_Spy1355, YP_598964.1, gi|94990864, GeneID:4063772
1356 1292670 1291942 729 - 32   1: 1 cwn
ff
Phage antirepressor protein MGAS10270_Spy1356, YP_598965.1, gi|94990865, GeneID:4063773
1357 1292872 1292681 192 - 10       ff conserved hypothetical protein - phage associated MGAS10270_Spy1357, YP_598966.1, gi|94990866, GeneID:4063774
1358 1293668 1294027 360 + 795       cwh
ff
Phage transcriptional regulator MGAS10270_Spy1358, YP_598967.1, gi|94990867, GeneID:4063775
1359 1294041 1294421 381 + 13       cwn
ff
Phage protein MGAS10270_Spy1359, YP_598968.1, gi|94990868, GeneID:4063776
1360 1294432 1294953 522 + 10       ff Hypothetical protein-phage associated MGAS10270_Spy1360, YP_598969.1, gi|94990869, GeneID:4063777
1361 1295069 1296226 1158 + 115 5 2: 2 6 cwn
ff
Phage integrase int1, MGAS10270_Spy1361, YP_598970.1, gi|94990870, GeneID:4063778
1362 1297443 1296337 1107 - 110     2: 3 4 ff
icw(2)
icw(2)
idu(2)
ilit(
8755589)
Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) / Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) msrA, MGAS10270_Spy1362, YP_598971.1, gi|94990871, GeneID:4063779
1363 1298109 1297486 624 - 42     1: 3 ff
icw(2)
icw(2)
isu
isu
Thiol:disulfide oxidoreductase associated with MetSO reductase tlpA, MGAS10270_Spy1363, YP_598972.1, gi|94990872, GeneID:4063780

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Phage_experimental RamyA Phage antirepressor protein


  Protein Sequence

>fig|370552.3.peg.1356 Phage antirepressor protein
MNNLITVTLNENQEPIVSGRDLHQALEIKTQYTKWLERMSDYGFEENEDYVAISQKRLTA
QGNQTEYTDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQIEKDFNSPEKIMARALLMADKK
VHKLEAQIEADRPKVLFADAVSASKSSCLIGELAKILKQNGVNIGQNKLFQWLRANGYLI
SRRGESWNQPTQKSMQLGLFELKKTAINHSDGHTTTNVTPKVTGKGQQYFINKFFNQEYL
PV

MD5 = 0dcbf70856f2d1002d0bb36e5b27bf2d


  DNA Sequence

>fig|370552.3.peg.1356 Phage antirepressor protein
atgaataatcttatcacagtaacactaaacgaaaaccaagaacctattgtttctggtcga
gatttgcatcaagcattagaaattaaaactcagtacacaaaatggttagaacgaatgtct
gattatgggtttgaagaaaatgaagactatgtagctattagtcaaaaaagactaacagct
cagggcaatcaaacagaatatacagaccacgttctaaaactagacatggctaaagaaatt
gcgatgcttcaacggaacgaaaagtctaaacaagtccgcaaatactttatccaaatcgaa
aaagacttcaacagccctgagaaaatcatggcaagggcgttactgatggcggataagaaa
gtgcataaacttgaagcacaaatcgaggcagaccgtcccaaagtactatttgctgatgct
gtaagtgctagcaaatcatcttgtctgattggtgagttagctaaaatcctgaaacagaat
ggagtcaatattggtcagaataagctatttcagtggttacgagccaacggctacctaatc
agtcgccgtggtgagtcttggaatcagccaacgcaaaaaagtatgcagcttggattgttt
gaactcaaaaaaacagccatcaatcactctgacggtcacactacaacaaatgtaacccca
aaagttactggtaaagggcaacaatactttattaataaattctttaaccaggaatatctg
ccagtttag


  DNA with Flanking Sequence

>fig|370552.3.peg.1356 Phage antirepressor protein
ctgacaggcctgctataagtcgcgctgcagtcgcccttatagtcagcgtcaggctccgtg
tgttaaacgtcttcgataaaaaacattgttgttacctagcttatataactcatctagtca
cagtacctttcaaaaattttgccaatttgcatcaactccttttttgtaataaaggtactt
tcattataaggttgtaagtcaaaaaaatcaagatggttacaaaaatcattgagcagaata
acgatttccgtatattttattaatattttctacttatttttgaaaaggaggtatataaat
gccagataacgcaatcgccatcgaaaaaataaagaagtatttgcttgataacaatcttaa
acaagttgatctagcagttacttatggcaaagaaccgcaagatgtggcgaatattcttgc
tggacgaaaaaaagacccagcatcaaatcgctttgtcttaaaagttatttcggatttaaa
aatcagatagaaggaataatatgaataatcttatcacagtaacactaaacgaaaaccaag
aacctattgtttctggtcgagatttgcatcaagcattagaaattaaaactcagtacacaa
aatggttagaacgaatgtctgattatgggtttgaagaaaatgaagactatgtagctatta
gtcaaaaaagactaacagctcagggcaatcaaacagaatatacagaccacgttctaaaac
tagacatggctaaagaaattgcgatgcttcaacggaacgaaaagtctaaacaagtccgca
aatactttatccaaatcgaaaaagacttcaacagccctgagaaaatcatggcaagggcgt
tactgatggcggataagaaagtgcataaacttgaagcacaaatcgaggcagaccgtccca
aagtactatttgctgatgctgtaagtgctagcaaatcatcttgtctgattggtgagttag
ctaaaatcctgaaacagaatggagtcaatattggtcagaataagctatttcagtggttac
gagccaacggctacctaatcagtcgccgtggtgagtcttggaatcagccaacgcaaaaaa
gtatgcagcttggattgtttgaactcaaaaaaacagccatcaatcactctgacggtcaca
ctacaacaaatgtaaccccaaaagttactggtaaagggcaacaatactttattaataaat
tctttaaccaggaatatctgccagtttagaaacgtaacaaaactaacgaagggagaaaag
tatgccagaggatttaatcaaacaactagaagctggttcagaatttctagcaaagacatg
tttacatagcaagattattatcacggtggatggtattcggcttgtggaaacaaaagagtt
ccacccagtgagcggaactctactagattagacaatacgtgtataagtgtgtatcttagc
taatctatgaatatttgagccaacagacccaacaagaacagaacggtattccgtttggct
tacattgtgataatggtaaatagaaccattattaaactcaacttccaaagtgttattttc
ccaatcaacacttcgggcgttactagatgaaacgtattgacgttgcataacttttcctcc
tttcgtaatgatagctttattatagcacgcaggaggaactacacagatagaaaggaaaac
cacatgagaccaaaacgatatccgtatagcgggaagaaaaacagaaaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT04SP1413 Streptococcus pyogenes MGAS315     antirepressor
cmr|NT06SP0636 Streptococcus pyogenes SSI-1     prophage LambdaSa1, antirepressor, putative
cmr|NT13SP1324 Streptococcus pyogenes MGAS6180     antirepressor
cmr|NT16SP1384 Streptococcus pyogenes MGAS10270     phage antirepressor protein
dbj|BAC63697.1 Streptococcus pyogenes SSI-1     putative P1-type antirepressor (phage associated)
fig|173707.1.peg.5 Temperate phage PhiNIH1.1 FIG   Phage antirepressor protein
fig|193567.1.peg.602 Streptococcus pyogenes SSI-1 FIG   Phage antirepressor protein
fig|193567.3.peg.655 Streptococcus pyogenes SSI-1 FIG   Phage antirepressor protein
fig|198466.1.peg.1261 Streptococcus pyogenes MGAS315 FIG   Phage antirepressor protein
fig|198466.3.peg.1357 Streptococcus pyogenes MGAS315 FIG   Phage antirepressor protein
fig|198541.1.peg.6 Streptococcus pyogenes phage 315.4 FIG   Phage antirepressor protein
fig|319701.3.peg.1661 Streptococcus pyogenes MGAS6180 FIG   Phage antirepressor protein
fig|319701.6.peg.1316 Streptococcus pyogenes MGAS6180 FIG   Phage antirepressor protein
fig|370552.4.peg.1381 Streptococcus pyogenes MGAS10270 FIG   Phage antirepressor protein
gb|AAL15047.1 temperate phage PhiNIH1.1     antirepressor
gb|AAM79868.1 Streptococcus pyogenes MGAS315     putative P1-type antirepressor - phage-associated
gb|AAX72390.1 Streptococcus pyogenes MGAS6180     phage antirepressor protein
gb|ABF34421.1 Streptococcus pyogenes MGAS10270     phage antirepressor protein
gi|16156173 temperate phage PhiNIH1.1 NCBI   antirepressor
gi|16271781 Temperate phage phiNIH1.1 NCBI   antirepressor
gi|21905001 Streptococcus pyogenes MGAS315 NCBI   putative P1-type antirepressor - phage-associated
gi|21910797 Streptococcus pyogenes MGAS315 NCBI   putative P1-type antirepressor - phage associated
gi|28810763 Streptococcus pyogenes SSI-1 NCBI   putative P1-type antirepressor (phage associated)
gi|28876375 Streptococcus pyogenes phage 315.4 NCBI   putative P1-type antirepressor
gi|28895514 Streptococcus pyogenes SSI-1 NCBI   putative P1-type antirepressor (phage associated)
gi|71803037 Streptococcus pyogenes MGAS6180 NCBI   phage antirepressor protein
gi|71903942 Streptococcus pyogenes MGAS6180 NCBI   phage antirepressor protein
gi|94544373 Streptococcus pyogenes MGAS10270 NCBI   phage antirepressor protein
gi|94990865 Streptococcus pyogenes MGAS10270 NCBI   phage antirepressor protein
img|637307790 Streptococcus pyogenes MGAS315 IMG   putative P1-type antirepressor - phage associated
img|637402575 Streptococcus pyogenes SSI-1 IMG   putative P1-type antirepressor (phage associated)
img|637675835 Streptococcus pyogenes MGAS6180 IMG   phage antirepressor protein
img|637992068 Streptococcus pyogenes MGAS10270 IMG   phage antirepressor protein
img|638289346 Temperate phage phiNIH1.1 IMG   antirepressor
img|638296794 Streptococcus pyogenes phage 315.4 IMG   putative P1-type antirepressor
kegg|spb:M28_Spy1280 Streptococcus pyogenes MGAS6180 (serotype M28) KEGG   phage antirepressor protein
kegg|spg:SpyM3_1261 Streptococcus pyogenes MGAS315 (serotype M3) KEGG   putative P1-type antirepressor - phage associated
kegg|sph:MGAS10270_Spy1356 Streptococcus pyogenes MGAS10270 (serotype M2) KEGG   phage antirepressor protein
kegg|sps:SPs0602 Streptococcus pyogenes SSI-1 (serotype M3) KEGG   putative P1-type antirepressor (phage associated)
ref|NP_438118.1 Temperate phage phiNIH1.1 RefSeq   antirepressor
ref|NP_665065.1 Streptococcus pyogenes MGAS315 RefSeq   putative P1-type antirepressor - phage associated
ref|NP_795546.1 Streptococcus pyogenes phage 315.4 RefSeq   putative P1-type antirepressor
ref|NP_801864.1 Streptococcus pyogenes SSI-1 RefSeq   putative P1-type antirepressor (phage associated)
ref|YP_280745.1 Streptococcus pyogenes MGAS6180 RefSeq   phage antirepressor protein
ref|YP_598965.1 Streptococcus pyogenes MGAS10270 RefSeq   phage antirepressor protein
tr|Q1CQ07 Streptococcus pyogenes serotype M2 (strain MGAS10270) TrEMBL   Phage antirepressor protein
tr|Q48SC0 Streptococcus pyogenes serotype M28 TrEMBL   Phage antirepressor protein
tr|Q79XW8 Streptococcus pyogenes serotype M3 TrEMBL   Putative P1-type antirepressor (Phage associated)
tr|Q938N5 Temperate phage phiNIH1.1 TrEMBL   Antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|370552.3.peg.1344 Single-stranded DNA-binding protein # phage-related
4 fig|370552.3.peg.1345 Phage single-strand DNA binding protein
4 fig|370552.3.peg.1346 Phage protein
4 fig|370552.3.peg.1347 hypothetical protein - phage associated
4 fig|370552.3.peg.1349 hypothetical protein
5 fig|370552.3.peg.1350 DNA replication protein DnaD
4 fig|370552.3.peg.1352 Phage protein
5 fig|370552.3.peg.1361 Phage integrase


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33363 969.800;5-115
CDD::33443 972.100;106-241
CDD::43300 947.700;106-240
CELLO::cytoplasm 3.997
evidence_code cwn
evidence_code ff
IPR::IPR005039 897.700;106-240
IPR::IPR005039 959.600;17-86
IPR::IPR005039_interpro_download 352.7;106-240
IPR::IPR013557_interpro_download 148.5;17-86
isoelectric_point 9.71
molecular_weight 27843
PFAM::PF03374 897.620;106-240
PFAM::PF03374_interpro_download 352.7;106-240
PFAM::PF08346 959.180;17-86
PFAM::PF08346_interpro_download 148.5;17-86
PSORT::Cytoplasmic 8.87
PSORT_score::Cytoplasmic 8.87
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search