The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|360109.10.peg.845: Campylobacter jejuni subsp. doylei 269.97

This feature in The SEED Viewer

NCBI Taxonomy Id: 360109

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_009707 from base 752154 to 764074 (11921 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
839 754556 752154 2403 -           HD domain protein locus|JJD26997_0836, protein_id|YP_001397961.1, gi|153951491, geneID|5388615
840 755916 754549 1368 - -8         TraD, putative locus|JJD26997_0837, protein_id|YP_001397962.1, gi|153951180, geneID|5388780
841 756668 755931 738 - 14 5     hypothetical protein locus|JJD26997_0838, protein_id|YP_001397963.1, gi|153951248, geneID|5388726
842 756934 756665 270 - -4         putative antirepressor locus|JJD26997_0839, protein_id|YP_001397964.1, gi|153952214, geneID|5389170
843 757755 756952 804 - 17         hypothetical protein locus|JJD26997_0840, protein_id|YP_001397965.1, gi|153950995, geneID|5390419
844 758321 757755 567 - -1 7     hypothetical protein locus|JJD26997_0841, protein_id|YP_001397966.1, gi|153951956, geneID|5388599
845 759092 758334 759 - 12       Phage antirepressor protein  
846 759384 759073 312 - -20         putative antirepressor  
847 760207 759518 690 - 133         hypothetical protein locus|JJD26997_0844, protein_id|YP_001397967.1, gi|153951435, geneID|5389553
848 760475 761041 567 + 267         hypothetical protein locus|JJD26997_0845, protein_id|YP_001397968.1, gi|153951325, geneID|5389372
849 761358 761501 144 + 316         hypothetical protein locus|JJD26997_0846, protein_id|YP_001397969.1, gi|153951684, geneID|5388858
850 762357 762812 456 + 855         hypothetical protein locus|JJD26997_0847, protein_id|YP_001397970.1, gi|153952432, geneID|5389619
851 763349 763777 429 + 536     3: 1 3 2   Single-stranded DNA-binding protein locus|JJD26997_0848, protein_id|YP_001397971.1, gi|153950985, geneID|5389850
852 763868 764074 207 + 90         hypothetical protein locus|JJD26997_0849, protein_id|YP_001397972.1, gi|153952606, geneID|5389721

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|360109.10.peg.845 Phage antirepressor protein
MNLEIFKKDDLQVRVIKDENNEPLFCLKDVCDVLELTNSRMVSEAVKREFEDDVSLTYPI
QDSLGRMQNATFITEPQLYYVMNNSRSKNAKTFRMWVNKEVLPSIRKKGYYSINQDFHPD
YDIVKKQNDILNEMVCTQNNTIYNLKEAIKVLNTSVQTLKEVNKFKSNENIKKEYDTNNN
PSELYSDLRKLVNTLASKANGDHRNIWKDVYSELANNFNIKKRIQVDDIKKDKAYLLHLI
DYLKRKIECEVI

MD5 = eee11bd549bde0e15ec52e31094839c1


  DNA Sequence

>fig|360109.10.peg.845 Phage antirepressor protein
atgaatttagaaatatttaaaaaagatgatttacaagttagagtgataaaagatgaaaat
aatgagcctttgttttgcttaaaagatgtgtgtgatgttttagagcttacaaatagtaga
atggtttcagaagcggtaaaaagggaatttgaagatgatgtaagtttaacttaccccatc
caagatagcttaggaagaatgcaaaatgctacctttattacagaaccacaactttactat
gtaatgaataatagccgaagtaaaaacgcgaaaacttttagaatgtgggtaaataaagaa
gtcttgccaagcattagaaaaaaaggttattatagcattaatcaagattttcatcctgat
tatgatattgtcaaaaaacaaaatgacatattaaatgaaatggtttgtactcaaaataat
acaatctataatttaaaagaagctataaaagtattaaacacttctgttcaaactttaaaa
gaagttaacaaattcaaatcaaatgaaaatatcaaaaaagagtatgacacaaataataat
ccctctgaactttactcagatcttagaaagctagttaatactttagcatctaaagctaat
ggtgatcatagaaatatttggaaagatgtttattcagagcttgccaataattttaatatc
aagaaaagaattcaggttgatgatataaaaaaagataaagcttatttattgcacttaatt
gactacttaaaaagaaaaatagaatgcgaagttatttaa


  DNA with Flanking Sequence

>fig|360109.10.peg.845 Phage antirepressor protein
atgcctacaaaagatcaaatcaaaaacacaatgcgtgtagcaaatacttttcttgacatt
caagtaagaaactaatttaaaaaggagaaaatatgtaatgaataatagccgaagtaaaaa
cgcgaaaacttttagaatgtgggtaaataaagaagtcttacctagtattagaaaaatatg
aaaattattaatttaaaaaggagaaaaaatgaatttagaaatatttaaaaaagatgattt
agaagttagagtgataaaggatgagaataatgagcctttattttgcttgagtgatatttg
taagattttagaacttacaacacctgcaaaagtagcggacactataaaaagggagtttga
gctgtatgaattaaactcacatagctttgatacaggttttggtatcaaagaattcactat
gattactgagccacagctttattttgttttaatgagaagcgacaagccaaatgcaaaaca
ttttagacaaaggagaaaaaatgaatttagaaatatttaaaaaagatgatttacaagtta
gagtgataaaagatgaaaataatgagcctttgttttgcttaaaagatgtgtgtgatgttt
tagagcttacaaatagtagaatggtttcagaagcggtaaaaagggaatttgaagatgatg
taagtttaacttaccccatccaagatagcttaggaagaatgcaaaatgctacctttatta
cagaaccacaactttactatgtaatgaataatagccgaagtaaaaacgcgaaaactttta
gaatgtgggtaaataaagaagtcttgccaagcattagaaaaaaaggttattatagcatta
atcaagattttcatcctgattatgatattgtcaaaaaacaaaatgacatattaaatgaaa
tggtttgtactcaaaataatacaatctataatttaaaagaagctataaaagtattaaaca
cttctgttcaaactttaaaagaagttaacaaattcaaatcaaatgaaaatatcaaaaaag
agtatgacacaaataataatccctctgaactttactcagatcttagaaagctagttaata
ctttagcatctaaagctaatggtgatcatagaaatatttggaaagatgtttattcagagc
ttgccaataattttaatatcaagaaaagaattcaggttgatgatataaaaaaagataaag
cttatttattgcacttaattgactacttaaaaagaaaaatagaatgcgaagttatttaaa
aaggagaaaaaatgaataatgtaataattatcaataatcaagaagttgtttttgaaaaca
aagatgaacaagttttttgcacaagtttagacatagctaaagtgtttgggaagaatcatt
ttcatgttttaagggatattgagaacattttaaacgatttgcgagaaataggggatttac
aatgtaaatccaattttggattggttaaatataaagataaaaaaggcgaatttagaccag
cttatcaaatatctcgtgatggattctctcttttagcgatgggctttacaggcaaaaaag
cattacaatggaaaatgctttttatcaatgcttttaatgagatggaaaacattattaaaa
gcaataatcaaactactaattattctgattatgaatttatcaaaaaacaaaacgacattt
taaatcaaataacttgcactcaaagcaatacaatctatgttttacaagatagcatcagat
ttttaaacaatactattag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|360109.7.peg.857 Campylobacter jejuni subsp. doylei 269.97 FIG   Phage antirepressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|360109.10.peg.841 hypothetical protein
7 fig|360109.10.peg.844 hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search