The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|351745.7.peg.2309: Shewanella sp. W3-18-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 351745

Current Assignment: Phage tail length tape-measure protein 1
Translate Function Assignments



Context on contig NC_008750 from base 2843046 to 2857169 (14124 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2302 2843759 2843046 714 -   4 1: 1 cwn
ff
Phage tail assembly protein #Phage tail assembly protein K Sputw3181_2462, YP_963840.1, gi|120599266, InterPro:IPR000064, InterPro:IPR000555, GeneID:4659290
2303 2844536 2843811 726 - 51     1: 1 cwn
ff
Phage minor tail protein #Phage minor tail protein L Sputw3181_2463, YP_963841.1, gi|120599267, InterPro:IPR006487, GeneID:4659352
2304 2844816 2844529 288 - -8         FIG01061737: hypothetical protein Sputw3181_2464, YP_963842.1, gi|120599268, GeneID:4659415
2305 2846077 2844803 1275 - -14         DGR reverse transcriptase Sputw3181_2465, YP_963843.1, gi|120599269, InterPro:IPR000477, GeneID:4659465
2306 2847692 2846487 1206 - 409         hypothetical protein Sputw3181_2467, YP_963845.1, gi|120599271, GeneID:4659516
2307 2848067 2847732 336 - 39 4 1: 1 cwn
ff
Phage minor tail protein #tail protein M Sputw3181_2468, YP_963846.1, gi|120599272, InterPro:IPR010265, GeneID:4659540
2308 2848376 2848071 306 - 3         hypothetical protein Sputw3181_2469, YP_963847.1, gi|120599273, GeneID:4659547
2309 2851794 2848378 3417 - 1   1: 1 ff Phage tail length tape-measure protein 1 Sputw3181_2470, YP_963848.1, gi|120599274, InterPro:IPR006431, InterPro:IPR009628, GeneID:4659657
2310 2852018 2851875 144 - 80       ff FIG01060123: hypothetical protein Sputw3181_2471, YP_963849.1, gi|120599275, GeneID:4659654
2311 2852551 2852057 495 - 38       ff Lambda gpG analog Sputw3181_2472, YP_963850.1, gi|120599276, GeneID:4660239
2312 2853114 2852641 474 - 89       cwn
ff
prophage LambdaSo, major tail protein V, putative Sputw3181_2473, YP_963851.1, gi|120599277, GeneID:4660250
2313 2853573 2853205 369 - 90       ff FIG01058875: hypothetical protein Sputw3181_2474, YP_963852.1, gi|120599278, GeneID:4659673
2314 2854034 2853570 465 - -4       ff FIG01060436: hypothetical protein Sputw3181_2475, YP_963853.1, gi|120599279, InterPro:IPR010064, InterPro:IPR011693, GeneID:4659676
2315 2854398 2854036 363 - 1         FIG01062602: hypothetical protein Sputw3181_2476, YP_963854.1, gi|120599280, InterPro:IPR006453, InterPro:IPR013045, GeneID:4659902
2316 2854694 2854398 297 - -1         FIG01061788: hypothetical protein Sputw3181_2477, YP_963855.1, gi|120599281, GeneID:4659628
2317 2855015 2854716 300 - 21     1: 4   TolA protein Sputw3181_2478, YP_963856.1, gi|120599282, GeneID:4659580
2318 2856302 2855112 1191 - 96     1: 3 ff
idu(3)
Phage major capsid protein #Fam0024 Sputw3181_2479, YP_963857.1, gi|120599283, InterPro:IPR006444, GeneID:4659082
2319 2857169 2856315 855 - 12     1: 2 ff
isu
Prophage Clp protease-like protein Sputw3181_2480, YP_963858.1, gi|120599284, InterPro:IPR001907, GeneID:4660020

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Phage_tail_proteins_2 RamyA Phage tail length tape-measure protein 1


  Protein Sequence

>fig|351745.7.peg.2309 Phage tail length tape-measure protein 1
MANKSLGTLTLNMFAETGSFVEGMSKAERASLKAENATARMVKQIDPLISQLSSLEVQQR
RLAELNDKGIFNGREFEILSERLEQTKNATYEANSAFADQYKQINRVVSQLDPAIAKYAE
LDNMQARLSEGVKVGVISGEDFTKYNSQLATMREEYDRVYTASGRLQSAQQKEQVELQGL
LRQLDPVTAKLAELESQNTKLSAAFAAGHIDKGQYDSAIVKLNQMRSAIDGTTEAQMKAE
AATKQQQSELQRLQQRLDPVIFEIRELDKAQELLRSSSAKGLINSSEYGLYSKRLAQMRS
EVGKTSVEFDKNGLSAKQLAFALRGVPAQFTDIAVSLQGGQNPLTVLLQQGGQLKDMFGG
VGPAAKAMGGYILGLINPFTIAASAAGVMSLAYYQGSVEADRLRNALILTGNSAGTTSDE
LMDAAKRIDAISGTQRQAAAALAEVANTGKFFGDQIELVGLAAIKMEKVTGKAMSETIAE
FVKLADDPVKAAEELNKKYNFLTASVYEQAAALKEAGKSNEAADLVFKAYSDAIDDRTSD
ITENLGYIEQAWKAVKDISAEAWDATVGIGRPDTLNDKLAENAKKIFELAAQGKGSNGVA
VYRERAMKALMEENKQIRDQIDLESKRAKQEAERAKISKDSIAAQRENAKLTEETLTNEQ
KRTKAIKEYKDNIEKIRKDNPNSALLDPDTIKRDLASIEKKFKDTAKKTKAFADDAATTY
LMRLRETQAGLQGQLESNIKLTQSQKELIQFEQQIADIKNKDVLTAQQKSLLAEQSVIRA
QLEKNVALDEELKKRNESLRLQSYSANLAANLAAEQQRNADKLASFGLGDKAQQRLGDRQ
SIEREIESAKGKALSDNLAGRTTDEEYQQQLLMLKDHQAKLLDEKNAYYIALDAKQADWT
NGARSSMENYIDAAADMAGQTERLMDNAFGGMTDALTDFVTSGKADFAELTKSILADLAK
IAMQKAIAGFIGSMFGFADGGVVGGSSASDYTGDAYQKWIKNGKSSGGYTGAGGKYEPAG
IVHKGEVVWSQQDIARAGGVATVEAMRKGHKGYADGGVVGGAAYNGVPAAAMAGTSPNVI
INQQIIVPESNNNNGANNTNMNEVIKAYAESSKQGTKTQIALELRPGGMIWRAMKGGY

MD5 = 018545d5b7b0bae9b6297441fdb5bdfc


  DNA Sequence

>fig|351745.7.peg.2309 Phage tail length tape-measure protein 1
atggcaaataagtcactcggcacactaacgctaaacatgtttgccgaaacgggcagcttt
gttgaaggcatgagtaaagctgagcgtgcatcattaaaggctgaaaatgcgacagccaga
atggtgaaacagattgatccgctgatatcacagctatctagcctagaagttcagcagcgc
cgtcttgcagagttaaatgacaagggaatatttaatggtcgtgagttcgaaatcttatcg
gaacgcttagaacaaactaaaaatgccacgtatgaagcaaactcggctttcgctgaccaa
tacaagcaaatcaaccgagtcgtaagccagctagaccctgcaatcgctaaatatgccgaa
ttagacaacatgcaagcgcggttatctgaaggcgtaaaagtgggtgttatcagtggcgaa
gatttcacaaaatataattctcagctagcgacaatgcgtgaagagtatgaccgagtttat
accgcctctggtcggctgcaatctgctcagcaaaaagaacaagttgaactgcaaggactg
ttacgtcagctagacccagtaacagcaaaactggcagagttagaatcgcaaaatactaaa
ctatcagcggccttcgctgcaggtcatatagataagggacaatacgatagcgcaatagta
aagcttaaccaaatgcgctcggccattgatggcacaacagaagcgcaaatgaaggctgag
gcggcaaccaagcaacagcagtccgaactgcaacggctgcagcaaagacttgatcctgtc
atctttgaaattcgcgagcttgataaagcgcaagagttattaaggtcgagctcagccaaa
ggcttaataaattcatctgaatatggtctttactctaaacgtttagcacaaatgcgcagt
gaagttggcaagaccagcgttgagtttgataaaaatggtttatcagccaagcaattggct
tttgcattgcgtggtgtgccagcccagttcaccgatatcgccgtatcgctccaaggtggt
caaaacccattaactgttttattgcaacaaggcggacagttaaaggatatgtttggcggt
gttggcccagcggctaaagccatgggcggctacatactgggattaattaacccgttcacc
attgcagcctctgcggctggcgtaatgtcgctggcgtattaccaaggcagtgttgaggca
gataggctgcgtaatgcattaatactgacgggcaattctgcaggcactacttcagatgaa
ttaatggatgccgccaagcgcatcgatgccattagcggcactcagcgccaagccgctgct
gcattagctgaggttgcgaatacaggcaaattctttggcgaccaaatcgagctcgttggc
cttgcggccataaaaatggaaaaagtcactggcaaagcaatgagtgaaaccattgcggaa
tttgtcaaactcgccgatgacccggttaaagccgccgaagaactcaacaaaaaatataac
ttcctcactgcatctgtttatgagcaagccgccgcacttaaagaggctggcaaatcaaac
gaagcagcagatttagtattcaaagcatatagcgatgctattgatgaccgcacaagcgat
atcactgaaaatcttggttatattgagcaagcatggaaggcggtaaaagatatatccgca
gaagcatgggacgccactgtcggcattggtcgtcctgacacactgaatgataagttggct
gaaaatgccaaaaaaatatttgagcttgcagctcaaggaaaagggagtaatggtgttgct
gtttatcgcgaaagagcgatgaaagctttgatggaagaaaataaacaaatccgagatcaa
attgatcttgaatctaaaagagcaaagcaagaggctgaacgcgccaagataagtaaagac
tcaattgccgcccagcgagaaaacgccaaattaacggaagaaacccttaccaatgagcaa
aagcgcaccaaggcgataaaggaatacaaagacaatattgaaaaaatacgcaaggacaat
cccaatagcgccttgctggatccagatactattaaacgtgatctggcatcgatagagaaa
aagttcaaagacactgctaaaaagaccaaagcctttgctgacgatgccgccactacgtat
ctcatgcgtttgcgcgaaacccaagcaggcttgcaaggtcagctagagtcaaatatcaag
cttactcagtcgcaaaaagagttaatccagtttgagcagcaaatcgctgacatcaaaaat
aaagatgtactcacggcccaacaaaaaagcctgttagctgagcaatctgttatccgtgcc
cagcttgaaaaaaacgtcgctctcgatgaagaacttaaaaagcgcaatgaatctttgcgg
ctgcaaagctacagtgccaaccttgccgccaacttggccgcagaacaacaacgcaatgcc
gacaaactcgccagctttggcttaggcgataaagcacaacaacgcctaggtgatcgccaa
agcattgagcgcgaaatagaaagcgccaagggaaaagcattatccgataacctagctggc
agaacgactgacgaagaatatcaacagcagttgttgatgctaaaagatcatcaagcaaaa
ctgcttgatgaaaaaaatgcgtattacatcgccctcgacgccaaacaagccgattggaca
aatggtgcccgttcatcaatggagaattacattgatgctgccgccgatatggcagggcag
acagagcggttaatggataacgcttttggtggtatgaccgacgcgcttaccgactttgtc
acctcaggtaaggccgactttgcggagctaaccaagtctatcttggctgatcttgccaaa
atcgccatgcaaaaagccattgctggatttattggcagcatgtttgggtttgcagatggt
ggggttgttggaggtagtagtgcatccgattacaccggagacgcttatcaaaaatggatt
aaaaacggcaaatcatcaggcggatacactggcgcgggtggcaagtatgagcctgctggc
atcgtgcataaaggtgaggtggtttggtcacaacaagatatcgcccgtgcgggtggtgtg
gccacggttgaagccatgcgtaaaggccacaaaggctatgcggacggtggtgtagttggc
ggcgcagcctataacggcgttcctgctgccgcaatggctggaacaagtcctaacgtcatc
atcaatcagcaaattattgtgccagaaagtaataacaataacggggctaacaatacaaat
atgaacgaggttattaaggcttacgcggagtcatctaagcaaggtactaaaacacaaatc
gcgctagaacttagaccgggtggaatgatttggcgagcaatgaagggagggtattaa


  DNA with Flanking Sequence

>fig|351745.7.peg.2309 Phage tail length tape-measure protein 1
caatgacgcccatggtccaatctgcgactcactcggtatggcgttaatcggcgctattaa
cgaagtcaatggcatcggactaaaacctgacccaaaagccttaccgccgacgacgaattc
tggcacgaactcgtcctcgcaggcgttggcggacgaaccattgaagaagcccagcaaaac
ctcacgcaccgagaagtcatcaactggatcgcctaccgagcaaagttcggccctttaagc
cttcaagcacggcaagaacgcattgccgcagcgcaaatgcaccacctcaatatcattcac
ggcggcaaagccgatcttgaatacttcatgttgttcagccagttggatgaagcgccgcag
caagaagccaccgttgatgacgtgcttatgatgctaaaagccagtgccatcaaaaagtaa
ttcaaattagtagcaataaggccaaggacggccagcctaatgcagtaaaaccaaagtcct
taaaccaagcaggaatccccatggcaaataagtcactcggcacactaacgctaaacatgt
ttgccgaaacgggcagctttgttgaaggcatgagtaaagctgagcgtgcatcattaaagg
ctgaaaatgcgacagccagaatggtgaaacagattgatccgctgatatcacagctatcta
gcctagaagttcagcagcgccgtcttgcagagttaaatgacaagggaatatttaatggtc
gtgagttcgaaatcttatcggaacgcttagaacaaactaaaaatgccacgtatgaagcaa
actcggctttcgctgaccaatacaagcaaatcaaccgagtcgtaagccagctagaccctg
caatcgctaaatatgccgaattagacaacatgcaagcgcggttatctgaaggcgtaaaag
tgggtgttatcagtggcgaagatttcacaaaatataattctcagctagcgacaatgcgtg
aagagtatgaccgagtttataccgcctctggtcggctgcaatctgctcagcaaaaagaac
aagttgaactgcaaggactgttacgtcagctagacccagtaacagcaaaactggcagagt
tagaatcgcaaaatactaaactatcagcggccttcgctgcaggtcatatagataagggac
aatacgatagcgcaatagtaaagcttaaccaaatgcgctcggccattgatggcacaacag
aagcgcaaatgaaggctgaggcggcaaccaagcaacagcagtccgaactgcaacggctgc
agcaaagacttgatcctgtcatctttgaaattcgcgagcttgataaagcgcaagagttat
taaggtcgagctcagccaaaggcttaataaattcatctgaatatggtctttactctaaac
gtttagcacaaatgcgcagtgaagttggcaagaccagcgttgagtttgataaaaatggtt
tatcagccaagcaattggcttttgcattgcgtggtgtgccagcccagttcaccgatatcg
ccgtatcgctccaaggtggtcaaaacccattaactgttttattgcaacaaggcggacagt
taaaggatatgtttggcggtgttggcccagcggctaaagccatgggcggctacatactgg
gattaattaacccgttcaccattgcagcctctgcggctggcgtaatgtcgctggcgtatt
accaaggcagtgttgaggcagataggctgcgtaatgcattaatactgacgggcaattctg
caggcactacttcagatgaattaatggatgccgccaagcgcatcgatgccattagcggca
ctcagcgccaagccgctgctgcattagctgaggttgcgaatacaggcaaattctttggcg
accaaatcgagctcgttggccttgcggccataaaaatggaaaaagtcactggcaaagcaa
tgagtgaaaccattgcggaatttgtcaaactcgccgatgacccggttaaagccgccgaag
aactcaacaaaaaatataacttcctcactgcatctgtttatgagcaagccgccgcactta
aagaggctggcaaatcaaacgaagcagcagatttagtattcaaagcatatagcgatgcta
ttgatgaccgcacaagcgatatcactgaaaatcttggttatattgagcaagcatggaagg
cggtaaaagatatatccgcagaagcatgggacgccactgtcggcattggtcgtcctgaca
cactgaatgataagttggctgaaaatgccaaaaaaatatttgagcttgcagctcaaggaa
aagggagtaatggtgttgctgtttatcgcgaaagagcgatgaaagctttgatggaagaaa
ataaacaaatccgagatcaaattgatcttgaatctaaaagagcaaagcaagaggctgaac
gcgccaagataagtaaagactcaattgccgcccagcgagaaaacgccaaattaacggaag
aaacccttaccaatgagcaaaagcgcaccaaggcgataaaggaatacaaagacaatattg
aaaaaatacgcaaggacaatcccaatagcgccttgctggatccagatactattaaacgtg
atctggcatcgatagagaaaaagttcaaagacactgctaaaaagaccaaagcctttgctg
acgatgccgccactacgtatctcatgcgtttgcgcgaaacccaagcaggcttgcaaggtc
agctagagtcaaatatcaagcttactcagtcgcaaaaagagttaatccagtttgagcagc
aaatcgctgacatcaaaaataaagatgtactcacggcccaacaaaaaagcctgttagctg
agcaatctgttatccgtgcccagcttgaaaaaaacgtcgctctcgatgaagaacttaaaa
agcgcaatgaatctttgcggctgcaaagctacagtgccaaccttgccgccaacttggccg
cagaacaacaacgcaatgccgacaaactcgccagctttggcttaggcgataaagcacaac
aacgcctaggtgatcgccaaagcattgagcgcgaaatagaaagcgccaagggaaaagcat
tatccgataacctagctggcagaacgactgacgaagaatatcaacagcagttgttgatgc
taaaagatcatcaagcaaaactgcttgatgaaaaaaatgcgtattacatcgccctcgacg
ccaaacaagccgattggacaaatggtgcccgttcatcaatggagaattacattgatgctg
ccgccgatatggcagggcagacagagcggttaatggataacgcttttggtggtatgaccg
acgcgcttaccgactttgtcacctcaggtaaggccgactttgcggagctaaccaagtcta
tcttggctgatcttgccaaaatcgccatgcaaaaagccattgctggatttattggcagca
tgtttgggtttgcagatggtggggttgttggaggtagtagtgcatccgattacaccggag
acgcttatcaaaaatggattaaaaacggcaaatcatcaggcggatacactggcgcgggtg
gcaagtatgagcctgctggcatcgtgcataaaggtgaggtggtttggtcacaacaagata
tcgcccgtgcgggtggtgtggccacggttgaagccatgcgtaaaggccacaaaggctatg
cggacggtggtgtagttggcggcgcagcctataacggcgttcctgctgccgcaatggctg
gaacaagtcctaacgtcatcatcaatcagcaaattattgtgccagaaagtaataacaata
acggggctaacaatacaaatatgaacgaggttattaaggcttacgcggagtcatctaagc
aaggtactaaaacacaaatcgcgctagaacttagaccgggtggaatgatttggcgagcaa
tgaagggagggtattaaggtgtatcaatataacaaagaggtattaattaccttgctaagt
gattccgctattcagtttttctttaatgatgtcacccataatacaactgcaatagaaatt
cgggagagagtgagagcgttttctgaggttttagcgggaattttagtcactgtttctgcc
gatggtgattaccgcatggatattgccaagcagctaaacgccaaaacgcagcaagtgacc
gctgatatggaagccatgatgattgaatctttgcagccaaatgggtttatttggcagaaa
attcaaaaaatgaaaggcttataaataatgcctcaaacattcacatgggcaccagataat
ggcgccacaggcgacacccaatatcgcactcgctctgcccagtttggtgatggctacagc
caatcagtaggcgatggcattaacagcaaggtgcaaagctggccgctaacgttcaccaaa
aacaaagccacggcggaggcgatagtcgcctttcttg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|351745.9.peg.2585 Shewanella sp. W3-18-1 FIG   Phage tail length tape-measure protein 1
gb|ABM25294.1 Shewanella sp. W3-18-1     phage tail tape measure protein, lambda family
gi|120559367 Shewanella sp. W3-18-1 NCBI   phage tail tape measure protein, lambda family
gi|120599274 Shewanella sp. W3-18-1 NCBI   lambda family phage tail tape measure protein
img|639816561 Shewanella sp. W3-18-1 IMG   phage tail tape measure protein, lambda family
kegg|shw:Sputw3181_2470 Shewanella sp. W3-18-1 KEGG   lambda family phage tail tape measure protein
ref|YP_963848.1 Shewanella sp. W3-18-1 RefSeq   lambda family phage tail tape measure protein
tr|A1RKU9 Shewanella sp. (strain W3-18-1) TrEMBL   Phage tail tape measure protein, lambda family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|351745.7.peg.2302 Phage tail assembly protein #Phage tail assembly protein K
4 fig|351745.7.peg.2307 Phage minor tail protein #tail protein M


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff
PSORT::unknown unknown
similar_to_human yes


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search