The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|351745.7.peg.2297: Shewanella sp. W3-18-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 351745

Current Assignment: Phage tail assembly protein I
Translate Function Assignments



Context on contig NC_008750 from base 2833092 to 2846077 (12986 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2296 2839295 2833092 6204 -   4 1: 2 cwn Phage tail fiber protein #Phage host specificity protein J Sputw3181_2456, YP_963834.1, gi|120599260, InterPro:IPR000276, InterPro:IPR003610, InterPro:IPR003961, GeneID:4659013
2297 2839951 2839301 651 - 5     cwn
ff
Phage tail assembly protein I Sputw3181_2457, YP_963835.1, gi|120599261, InterPro:IPR002173, InterPro:IPR010654, GeneID:4659601
2298 2840962 2840072 891 - 120         uncharacterized phage-encoded protein Sputw3181_2458, YP_963836.1, gi|120599262, GeneID:4659037
2299 2841633 2840959 675 - -4         Roi protein Sputw3181_2459, YP_963837.1, gi|120599263, InterPro:IPR010916, GeneID:4659015
2300 2841911 2842402 492 + 277         hypothetical protein Sputw3181_2460, YP_963838.1, gi|120599264, InterPro:IPR005569, GeneID:4658986
2301 2842959 2842441 519 - 38         lipoprotein, putative Sputw3181_2461, YP_963839.1, gi|120599265, InterPro:IPR000437, GeneID:4659240
2302 2843759 2843046 714 - 86 7 1: 1 cwn
ff
Phage tail assembly protein #Phage tail assembly protein K Sputw3181_2462, YP_963840.1, gi|120599266, InterPro:IPR000064, InterPro:IPR000555, GeneID:4659290
2303 2844536 2843811 726 - 51 5 1: 1 cwn
ff
Phage minor tail protein #Phage minor tail protein L Sputw3181_2463, YP_963841.1, gi|120599267, InterPro:IPR006487, GeneID:4659352
2304 2844816 2844529 288 - -8         FIG01061737: hypothetical protein Sputw3181_2464, YP_963842.1, gi|120599268, GeneID:4659415
2305 2846077 2844803 1275 - -14         DGR reverse transcriptase Sputw3181_2465, YP_963843.1, gi|120599269, InterPro:IPR000477, GeneID:4659465

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|351745.7.peg.2297 Phage tail assembly protein I
MNSQQLTTIKLSGSLAKKFGREHKRFLDTGTTTEAFSALKNTLQGFEGFIKEQAKLGLRY
AIFRNGKNTGEDEFDLAGTREIRIVPVIGGSKRAGVMQTIIGAVLIVVGVFTTIFGDYSG
SVIQVGVAMVAGGVVQMLSPQAKGLKGSEAAENAPSYAFGGAVNTTAAGNPVGIGYGKRR
IGGAIISAGIYAEDIATSQRPIQSGGSNGGGSQQEQ

MD5 = 772c2aeb258ba31babfe45fe851a7f9b


  DNA Sequence

>fig|351745.7.peg.2297 Phage tail assembly protein I
atgaactcacaacaactcaccacgataaaactatcaggatcgcttgctaaaaagtttggc
cgtgagcataagcgatttttagatacaggcaccacaactgaagcgtttagcgcccttaaa
aataccctgcaaggttttgaagggtttattaaggagcaagcaaaacttgggttgcgttac
gctatttttcgtaatggtaaaaacacaggcgaagatgaatttgatttagccggcactcgc
gagatcaggattgtgcctgttattggtggcagtaagcgagcaggagtaatgcaaactatt
attggcgctgttcttattgtcgttggcgtttttacaacaatattcggcgactatagcggt
tctgtaattcaggttggtgtggcaatggtcgccggcggcgtggtgcaaatgctgtcaccg
caagctaaggggttaaagggcagtgaggcggcggagaacgcgccaagctatgcctttggt
ggcgcggtcaacaccacggcagcgggtaatcctgttggcattggttacggcaagcgccgc
atcggtggtgcaattattagtgctggcatttatgcagaagacattgcaacaagccagcgc
ccaattcaatccggtggcagtaatggcggcggcagtcaacaggagcaataa


  DNA with Flanking Sequence

>fig|351745.7.peg.2297 Phage tail assembly protein I
atgcttacaaaataattcatcagcgctttaatgttgagcacatagatcagctcgaaaaag
gccagttaacagaagcgattgagtatgcgcataagttagcattagacggcgagtttatcc
ccgccgcccctgcaatcgcgccacaacctttgctaaatgagtacgatattcacaatatca
aagggctttgcactcatatggattatttgaaaaagtactttgacgaatacaagctgtatg
aggtgtttactatgcttggctctcgcgctggcacccagatgattgatcatatgcgtgatg
gtgtgtgttttgccgcaacggttagacgtagcataaacgaacttgaggcaaggggcttaa
aagcgatcttgcctagttagcctaaaggacttatcctgctataacaatccgaaaaaccct
ctttcgagaaagattatctaaagccgcctaatcaggcggcttttttattgccaaaaaatg
ctgatgacagcaggtctaatatgaactcacaacaactcaccacgataaaactatcaggat
cgcttgctaaaaagtttggccgtgagcataagcgatttttagatacaggcaccacaactg
aagcgtttagcgcccttaaaaataccctgcaaggttttgaagggtttattaaggagcaag
caaaacttgggttgcgttacgctatttttcgtaatggtaaaaacacaggcgaagatgaat
ttgatttagccggcactcgcgagatcaggattgtgcctgttattggtggcagtaagcgag
caggagtaatgcaaactattattggcgctgttcttattgtcgttggcgtttttacaacaa
tattcggcgactatagcggttctgtaattcaggttggtgtggcaatggtcgccggcggcg
tggtgcaaatgctgtcaccgcaagctaaggggttaaagggcagtgaggcggcggagaacg
cgccaagctatgcctttggtggcgcggtcaacaccacggcagcgggtaatcctgttggca
ttggttacggcaagcgccgcatcggtggtgcaattattagtgctggcatttatgcagaag
acattgcaacaagccagcgcccaattcaatccggtggcagtaatggcggcggcagtcaac
aggagcaataattagcatgggcatacctgcattaaatcaaccattactgatcagcggtga
aaaagctggacaagcaaaacaacgcacacctgtagaatcgcctgatgatctgcgctcaat
tgccaaagctaaagtgttgctggcaattggcgaaggggagtttgagggccaattatccgg
ccaaaatgtgtttttagatggcacgccattactcgatgcaaatggtgctgaaaacttccc
cggtgtgatttgggattttcgtccgggttctgtgtatcaaacgtatattcctggcttgcc
ctctgttgaaaacgaggtggcattaggtattgagttaaagtctgatcagccttacacgcg
cgccattacaaactcactgctctctgcggttcgtgtgcgatttcgctggccagcgctaca
acaacagcttgataacggtgatgtaaatggctatcgcattgaatacgccattgatctctc
tactgacggcggtagctatcagactgtgtta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|351745.9.peg.2572 Shewanella sp. W3-18-1 FIG   Phage tail assembly protein I
gb|ABM25281.1 Shewanella sp. W3-18-1     bacteriophage lambda tail assembly I
gi|120559354 Shewanella sp. W3-18-1 NCBI   bacteriophage lambda tail assembly I
gi|120599261 Shewanella sp. W3-18-1 NCBI   bacteriophage lambda tail assembly I
img|639816548 Shewanella sp. W3-18-1 IMG   bacteriophage lambda tail assembly I
kegg|shw:Sputw3181_2457 Shewanella sp. W3-18-1 KEGG   bacteriophage lambda tail assembly I
ref|YP_963835.1 Shewanella sp. W3-18-1 RefSeq   bacteriophage lambda tail assembly I
tr|A1RKT6 Shewanella sp. (strain W3-18-1) TrEMBL   Bacteriophage lambda tail assembly I


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|351745.7.peg.2296 Phage tail fiber protein #Phage host specificity protein J
7 fig|351745.7.peg.2302 Phage tail assembly protein #Phage tail assembly protein K
5 fig|351745.7.peg.2303 Phage minor tail protein #Phage minor tail protein L


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code cwn
evidence_code ff
PSORT::unknown unknown
similar_to_human yes


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search