The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|340186.5.peg.3884: Escherichia coli E110019

This feature in The SEED Viewer

NCBI Taxonomy Id: 340186

Current Assignment: Putative DNA-binding protein Roi of bacteriophage BP-933W
Translate Function Assignments



Context on contig NZ_AAJW02000030 from base 20971 to 31786 (10816 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3878 22821 20971 1851 -           hypothetical protein  
3879 23311 23144 168 - 322         hypothetical protein locus|EcE110019_4333, protein_id|ZP_03051452.1, gi|193070512
3880 23736 23308 429 - -4         hypothetical protein locus|EcE110019_4334, protein_id|ZP_03051442.1, gi|193070502
rna.53 23987 23911 77 - 174         tRNA-Pseudo-TCT  
rna.54 24064 23989 76 - 1         tRNA-Met-CAT  
3881 24539 24378 162 - 313         Phage antitermination protein Q locus|EcE110019_4337, protein_id|ZP_03051450.1, gi|193070510
3882 25528 24857 672 - 317         Phage serine/threonine protein phosphatase NinI (EC 3.1.3.16) locus|EcE110019_4338, protein_id|ZP_03051463.1, gi|193070523
3883 26130 25525 606 - -4 5     Protein NinG locus|EcE110019_4339, protein_id|ZP_03051411.1, gi|193070471
3884 26852 26130 723 - -1       Putative DNA-binding protein Roi of bacteriophage BP-933W locus|EcE110019_4340, protein_id|ZP_03051414.1, gi|193070474
3885 27604 26927 678 - 74         antirepressor-like protein locus|EcE110019_4341, protein_id|ZP_03051417.1, gi|193070477
3886 28586 28059 528 - 454         putative DNA methylase  
3887 28888 28583 306 - -4         Protein NinB  
3888 29222 28986 237 - 97         unknown protein encoded within prophage CP-933V  
3889 29859 29581 279 - 358         hypothetical protein locus|EcE110019_4344, protein_id|ZP_03051424.1, gi|193070484
3890 30220 29930 291 - 70         Phage exclusion protein ren locus|EcE110019_4345, protein_id|ZP_03051444.1, gi|193070504
3891 30918 30217 702 - -4         Origin specific replication binding factor  
3892 31289 30915 375 - -4         Replication protein O  
3893 31786 31229 558 - -61         Replication protein O  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|340186.5.peg.3884 Putative DNA-binding protein Roi of bacteriophage BP-933W
MNELINSNAIKMTSIEIAELVGSRHDKVKQSIERLAVRGVIRNPPMVVFEKINNLGLLRG
VEAYVFEGEQGKRDSIIVVAQLSPEFTARLVDRWRELEGATAKIPQTFSEALRLAADLED
QKAELEKQLALAAPKVEFADRVGESSGILIGNFAKVVGIGPNKLFAWMRDHKILIASGSR
RNVPMQEYMDRGYFTVKETAVNTNHGIQISFTTKITGRGQQWLTRKLLDNGMLKVTGEAA

MD5 = b97e28a7f1b0024ef8184b6f95c4e90e


  DNA Sequence

>fig|340186.5.peg.3884 Putative DNA-binding protein Roi of bacteriophage BP-933W
atgaatgagctgataaatagcaatgccatcaaaatgacaagcattgaaatcgctgagttg
gtgggaagtcgtcatgacaaggtgaaacaatccattgaacgactggcggttcgaggtgtg
atccgaaatcccccaatggtggttttcgaaaaaatcaataacttaggattacttcgtggc
gtagaggcttacgtttttgagggcgaacaaggtaagcgcgacagcattattgtcgttgcc
cagttgtcgccggaattcaccgctcgccttgttgaccgctggcgagaactcgaaggggca
accgcgaaaataccacaaaccttttctgaggcattgcgccttgcggccgaccttgaagac
cagaaggctgaactggagaaacagcttgctctcgcagcacctaaagttgagtttgccgat
cgcgttggcgagtccagcggaattttgattggaaactttgcaaaggttgttggtattggt
ccaaacaaactgtttgcgtggatgcgcgatcacaaaatccttattgcttcaggctcccgg
cgcaatgtgccaatgcaggaatatatggatcgtggctatttcacagtgaaagaaacagcg
gtcaacacaaatcacggaatacagatatcgttcaccacaaaaatcaccgggcgtggtcaa
cagtggctgacaagaaagctgctagataacggaatgcttaaagtaacaggggaggctgct
taa


  DNA with Flanking Sequence

>fig|340186.5.peg.3884 Putative DNA-binding protein Roi of bacteriophage BP-933W
tggacagaacgcggcgcagcccgtcacgcaaaaatgctcgaaaccgatcaggcgtgggat
gtgttcgaaaaactggaagactgctatttcagccagtgcgagaaaaatactggcaaacaa
gagaagaagctcaacgggctttccgcaaaagaaacagacagccttgtatggctgtgggat
tatgccaaccgctcacaggcattgttccgtgagttgtatcccgcattaaaactgattcag
tctggctattccggcatatgccacgactacggctatgagttctcgtatatcatcgggagg
gcgaggggcgttttaattaatcacacgcgggatatagatatttatgagcctgacgggccg
acgaaccttctggcatgggaaaggcttaagaacaaagagttgccgccttcactgcatcgc
tactgacaattgacaacttaacaaacccagcttcggctgggttttttattgctgaatttt
caatatgagaggacatgacaatgaatgagctgataaatagcaatgccatcaaaatgacaa
gcattgaaatcgctgagttggtgggaagtcgtcatgacaaggtgaaacaatccattgaac
gactggcggttcgaggtgtgatccgaaatcccccaatggtggttttcgaaaaaatcaata
acttaggattacttcgtggcgtagaggcttacgtttttgagggcgaacaaggtaagcgcg
acagcattattgtcgttgcccagttgtcgccggaattcaccgctcgccttgttgaccgct
ggcgagaactcgaaggggcaaccgcgaaaataccacaaaccttttctgaggcattgcgcc
ttgcggccgaccttgaagaccagaaggctgaactggagaaacagcttgctctcgcagcac
ctaaagttgagtttgccgatcgcgttggcgagtccagcggaattttgattggaaactttg
caaaggttgttggtattggtccaaacaaactgtttgcgtggatgcgcgatcacaaaatcc
ttattgcttcaggctcccggcgcaatgtgccaatgcaggaatatatggatcgtggctatt
tcacagtgaaagaaacagcggtcaacacaaatcacggaatacagatatcgttcaccacaa
aaatcaccgggcgtggtcaacagtggctgacaagaaagctgctagataacggaatgctta
aagtaacaggggaggctgcttaatggctaaaccagcgcgaaggaaatgcaaaatctgtaa
ggaatggtttcacccggcattctcaaatcagtggtggtgcagcccggaacacggaactaa
attagcgctcgaacgacgaaataaagaacgcgaaaaggcggaaaaaacagcagagaagaa
acgacgacgagaggagcagaaacagaaagataaaattaagattcgaaaactcgccttaaa
gccccgcagttactggattaaacaagcccaacaagccgtaaacgccttcatcagagaaag
agaccgcgacttaccatgtatctcgtgcggaacgctcacgtctgctcagtgggatgccgg
acattaccggacaactgctgcggcacctcaactccgatttgatgaacgcaatattcacaa
gcaatgcgtggtgtgcaaccagcacaaaagcggaaatctcgttccgtatcgcgtcgaact
gattagccgcatcgggcaggaagcagtagaggaaatcgaatca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
eric|ADM-0003413 Escherichia coli ASAP   COG3645: Uncharacterized phage-encoded protein
fig|340186.3.peg.3701 Escherichia coli E110019 FIG   Putative DNA-binding protein Roi of bacteriophage BP-933W
gb|EDV86631.1 Escherichia coli E110019     DNA-binding protein
gi|192956168 Escherichia coli E110019 NCBI   DNA-binding protein
gi|193070474 Escherichia coli E110019 NCBI   DNA-binding protein
img|638671944 Escherichia coli E110019 IMG   COG3645: Uncharacterized phage-encoded protein
ref|ZP_03051414.1 Escherichia coli E110019 RefSeq   DNA-binding protein
tr|B3IP78 Escherichia coli E110019 TrEMBL   DNA-binding protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|340186.5.peg.3883 Protein NinG


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search