The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|334413.6.peg.1188: Finegoldia magna ATCC 29328

This feature in The SEED Viewer

NCBI Taxonomy Id: 334413

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_010376 from base 1060778 to 1073362 (12585 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1184 1062544 1060778 1767 -       5: 5 9 2 4 12   Heterodimeric efflux ABC transporter, permease/ATP-binding subunit 1 locus|FMG_0979, protein_id|YP_001692287.1, gi|169824676, geneID|6018736
1185 1062760 1063731 972 + 215     1: 1   hypothetical protein locus|FMG_0980, protein_id|YP_001692288.1, gi|169824677, geneID|6018576
1186 1065633 1063780 1854 - 48         TrsK-like protein locus|FMG_0981, protein_id|YP_001692289.1, gi|169824678, geneID|6018879
1187 1066725 1065673 1053 - 39     1: 1   hypothetical protein locus|FMG_0982, protein_id|YP_001692290.1, gi|169824679, geneID|6020249
1188 1067452 1066718 735 - -8         Phage antirepressor protein locus|FMG_0983, protein_id|YP_001692291.1, gi|169824680, geneID|6018847
1189 1067934 1067449 486 - -4         DUF3801 protein locus|FMG_0984, protein_id|YP_001692292.1, gi|169824681, geneID|6018627
1190 1068754 1067927 828 - -8     1: 3   Phage DNA helicase loader locus|FMG_0985, protein_id|YP_001692293.1, gi|169824682, geneID|6018710
1191 1069524 1068751 774 - -4         replication initiator protein A locus|FMG_0986, protein_id|YP_001692294.1, gi|169824683, geneID|6018756
1192 1071863 1069953 1911 - 428     2: 13 7   Lysyl-tRNA synthetase (class II) (EC 6.1.1.6) locus|FMG_0987, protein_id|YP_001692295.1, gi|169824684, geneID|6018817
1193 1072345 1071866 480 - 2     1: 10   Transcription elongation factor GreA locus|FMG_0988, protein_id|YP_001692296.1, gi|169824685, geneID|6018709
1194 1073362 1072430 933 - 84     3: 6 8 11   tRNA-dihydrouridine synthase DusB locus|FMG_0989, protein_id|YP_001692297.1, gi|169824686, geneID|6020250

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|334413.6.peg.1188 Phage antirepressor protein
MISNLKTFENKNFGKLTVIEKDGEFFFIANEVATMLGYVNPRKAIYDHVDEEDKGVTKWN
TPGGIQNISIINESGLYSLILSSKLPQAKIFKAWVTREVLPSIRKNGGYIVGQEKKTNED
LLADAILVANRIIAEREEEIEELRPKADYYDKLVDYNLLTNFRNTAKELGIPQNQFISFL
MDKGLIYRDKKKKLLPYADKNKGYFEVKEWIDPLGTLVGIQTLITPKGRHYLLILLDSEG
FYDE

MD5 = b492925b732ba842aeaa4276d6f8bb37


  DNA Sequence

>fig|334413.6.peg.1188 Phage antirepressor protein
atgataagtaatctaaaaacatttgaaaataagaattttgggaaactcactgttattgaa
aaagatggtgagtttttctttatagcaaatgaagtagcaactatgctaggatatgtcaat
cccagaaaagctatttatgaccatgtagacgaagaagataagggtgtaacgaaatggaac
acccctggaggaatacagaatatttcaataattaacgaatcaggattgtattcacttatc
ctctcatcaaaactaccacaagcaaaaatattcaaagcttgggtaactagagaagtctta
ccaagtattagaaaaaacggaggatatatagtagggcaagaaaagaaaactaatgaagat
ctacttgcagatgcaattcttgtagccaatagaattattgctgaaagagaagaagaaatt
gaagaattaagaccaaaggcagattattatgacaaattagtagattataacctacttaca
aactttagaaatactgccaaagagttaggaataccacaaaatcaatttataagttttcta
atggataagggattaatttacagagataagaaaaagaaactcttaccttatgcagataag
aacaagggatattttgaagtaaaagaatggattgatccactaggtacacttgtaggaata
caaacattaataacaccaaagggaagacactacctactaattttattagatagtgaaggt
ttctacgatgaataa


  DNA with Flanking Sequence

>fig|334413.6.peg.1188 Phage antirepressor protein
tatatggaggtggaatagatgattaatgaagaagtatctaggtcgagtcttaaccttgaa
gtaaggcttgcaaaagcaacaagtaaagcaattcttgatgccttaaagaaagttcacaag
caaatagaagatcaaggaggcttgaaaaatgtaataaaaaataatggagaagaagtaaaa
ctaaaggatatggttaaaaagggacagttagaagaaattaatctaaaagatcctgagtta
aaagaattaaagaaaattttaaacaaacacggagtgaagttttctgttatgaaagataag
gaaactggtaaccactctgtgttttttcaatctaaggatataaaagtaatggaacacgcc
tttaaaaaagcagttaaggcttctgaaaaaaaggccgatagaaaagattcaataacgaag
actataaataagtttaaagatatggctaaggacaccattagtaaagataaagttaaaaat
aaacataaggagcaaagcttatgataagtaatctaaaaacatttgaaaataagaattttg
ggaaactcactgttattgaaaaagatggtgagtttttctttatagcaaatgaagtagcaa
ctatgctaggatatgtcaatcccagaaaagctatttatgaccatgtagacgaagaagata
agggtgtaacgaaatggaacacccctggaggaatacagaatatttcaataattaacgaat
caggattgtattcacttatcctctcatcaaaactaccacaagcaaaaatattcaaagctt
gggtaactagagaagtcttaccaagtattagaaaaaacggaggatatatagtagggcaag
aaaagaaaactaatgaagatctacttgcagatgcaattcttgtagccaatagaattattg
ctgaaagagaagaagaaattgaagaattaagaccaaaggcagattattatgacaaattag
tagattataacctacttacaaactttagaaatactgccaaagagttaggaataccacaaa
atcaatttataagttttctaatggataagggattaatttacagagataagaaaaagaaac
tcttaccttatgcagataagaacaagggatattttgaagtaaaagaatggattgatccac
taggtacacttgtaggaatacaaacattaataacaccaaagggaagacactacctactaa
ttttattagatagtgaaggtttctacgatgaataagatattagaagccattctttctgat
attaaaaacctaattaaaatagacaacccaaagaaatttatattatcaaacattccctat
ctatcattcttctacattggaaatatcttttctaagcacatcaattcttatgtaggagga
gatattattgataaaataatggtgggaatttctgatataggaactttatcttatatacca
agccttaatccaagggacttgttagtaggtatttcagttgctggtcttgttaagttaatt
gtttacagcaaaggtaaaaacaaaaagaaatataggcaaggcaaggaatatggatctgca
agatggggagaaagtaaggatattgctccatatattgaccctaagtttgaaaacaatgtt
ctcataactaataccgaaagactaacaatgaactcaagacctaaaaaccctaaatatgcc
agaaataaaaatgtattagtaataggtggttctggatcaggtaaaacgagatttt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
dbj|BAG08401.1 Finegoldia magna ATCC 29328     putative phage-associated antirepressor
gi|167831485 Finegoldia magna ATCC 29328 NCBI   putative phage-associated antirepressor
gi|169824680 Finegoldia magna ATCC 29328 NCBI   putative phage-associated antirepressor
img|641569700 Finegoldia magna ATCC 29328 IMG   putative phage-associated antirepressor
kegg|fma:FMG_0983 Finegoldia magna ATCC 29328 KEGG   putative phage-associated antirepressor
ref|YP_001692291.1 Finegoldia magna ATCC 29328 RefSeq   putative phage-associated antirepressor
tr|B0S211   TrEMBL   Putative phage-associated antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search