The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.13.peg.646: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_008530 from base 647029 to 657346 (10318 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
632 647029 647952 924 +           FIG00744143: hypothetical protein locus|LGAS_0645, protein_id|YP_814477.1, gi|116629305, geneID|4440168
633 647958 648263 306 + 5         Transcriptional regulator, xre family locus|LGAS_0646, protein_id|YP_814478.1, gi|116629306, geneID|4440169
634 648256 649041 786 + -8         Phage antirepressor protein locus|LGAS_0647, protein_id|YP_814479.1, gi|116629307, geneID|4440170
635 649056 649241 186 + 14         FIG00749519: hypothetical protein locus|LGAS_0648, protein_id|YP_814480.1, gi|116629308, geneID|4440171
636 649251 649463 213 + 9         FIG00745651: hypothetical protein locus|LGAS_0649, protein_id|YP_814481.1, gi|116629309, geneID|4440172
637 649656 649919 264 + 192         hypothetical protein locus|LGAS_0650, protein_id|YP_814482.1, gi|116629310, geneID|4440173
638 649916 650116 201 + -4         hypothetical protein  
639 650113 650469 357 + -4         FIG00746627: hypothetical protein locus|LGAS_0651, protein_id|YP_814483.1, gi|116629311, geneID|4440141
640 650539 650793 255 + 69         hypothetical protein locus|LGAS_0652, protein_id|YP_814484.1, gi|116629312, geneID|4440142
641 650806 651267 462 + 12         Holliday junction resolvase locus|LGAS_0653, protein_id|YP_814485.1, gi|116629313, geneID|4440143
642 651268 651489 222 + 0         hypothetical protein locus|LGAS_0654, protein_id|YP_814486.1, gi|116629314, geneID|4440144
643 651559 651690 132 + 69         hypothetical protein locus|LGAS_0655, protein_id|YP_814487.1, gi|116629315, geneID|4440145
644 651680 651970 291 + -11         FIG00751351: hypothetical protein locus|LGAS_0656, protein_id|YP_814488.1, gi|116629316, geneID|4440146
645 651973 652191 219 + 2         FIG00754532: hypothetical protein locus|LGAS_0657, protein_id|YP_814489.1, gi|116629317, geneID|4440147
646 652178 652345 168 + -14         hypothetical protein locus|LGAS_0658, protein_id|YP_814490.1, gi|116629318, geneID|4440148
647 652375 652905 531 + 29         FIG00747662: hypothetical protein locus|LGAS_0659, protein_id|YP_814491.1, gi|116629319, geneID|4440149
rna.19 653635 653707 73 + 729         tRNA-Gln-TTG  
648 653763 654047 285 + 55     4: 1 4 2 3   Chromosome (plasmid) partitioning protein ParB locus|LGAS_0661, protein_id|YP_814492.1, gi|116629320, geneID|4440151
rna.20 654299 654380 82 + 251         tRNA-Pseudo-???  
649 654488 655105 618 + 107         hypothetical protein locus|LGAS_0663, protein_id|YP_814493.1, gi|116629321, geneID|4440153
650 655288 655944 657 + 182         Phage terminase, large subunit locus|LGAS_0664, protein_id|YP_814494.1, gi|116629322, geneID|4440154
651 656005 656526 522 + 60         Phage terminase, small subunit locus|LGAS_0665, protein_id|YP_814495.1, gi|116629323, geneID|4440155
652 656615 657346 732 + 88         HNH homing endonuclease # Phage intron locus|LGAS_0666, protein_id|YP_814496.1, gi|116629324, geneID|4440156

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.13.peg.646 hypothetical protein
MDETRNDLEVGNETAVMMYLNILKYAKHHCPEDEDPYEITDRIFTDMFAANKASN

MD5 = 321f9e82429439fa616f2ddc80ed11c6


  DNA Sequence

>fig|324831.13.peg.646 hypothetical protein
atggacgaaactaggaacgatttagaagtaggcaatgaaacagcagtcatgatgtacttg
aacatcttaaagtatgctaagcatcattgtcccgaagatgaagatccttatgagatcacg
gatcgaatatttactgatatgttcgcagcgaataaagcaagtaattaa


  DNA with Flanking Sequence

>fig|324831.13.peg.646 hypothetical protein
ctatggcaattgagttaaagattggggctagaggaacgagagaagattttgaagacacat
atactagaagtttcttagaagataacggtctgtttaaatttgatccaagaaagtttacag
ttaactgtgtgtggggagttcatactaaatacggctatatgtgttctttcagttatgatg
acattttgacatacatgggcgatggtgtctgggacttaagagtagctgaagaaacaaaaa
taactgatgaagagttgaagagagcattatcagaacctgacaaggagttctagcaatgca
actatacgggcatgaagtaaatccttatacgtataaggattttaagacagaacaacttaa
gaattttagatcaatgcttaaatcaaacatcaagaattttgaaaatattatagagccaac
aatcgaagaaatgattgacgaagataaagctgaggagctgctgcctttgattgagcatga
aattaaagtgaggtcgaatgatggacgaaactaggaacgatttagaagtaggcaatgaaa
cagcagtcatgatgtacttgaacatcttaaagtatgctaagcatcattgtcccgaagatg
aagatccttatgagatcacggatcgaatatttactgatatgttcgcagcgaataaagcaa
gtaattaaacaactagaagacgagagggagtgtaagtgtgtatcagattgacttaggatt
acagccaaatttaagggctacagctaaaagggtggataagttcctgactattaattttca
gagctatcttaatttagctggcttacatcgtaatcagcttacaagccctcaattatcttt
tgcacctggatcgacaaacaaaaatggcgttgaaaagaactttattgacgaagcacaaga
cgatattgatattgctgatcctgctaggaaggtctgtgcagcgatttatcggacgatgga
taattgcactgatacatcattaaagccttacagacgtatcttaattggaacttacattga
ccagttacgtatcgttgatgtagcagctacagttaatttgtcgactaggtcaattgatac
taagaagattaatgctcagtgtgagttcgctgatagatggctttactggaaaaaatactt
tggtgttaatgatttacccgacttaaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.13.peg.585 Lactobacillus gasseri ATCC 33323 FIG   hypothetical protein
fig|363555.2.peg.26 Siphoviridae Lactobacillus phage KC5a FIG   hypothetical protein
gb|ABD78803.1 Lactobacillus gasseri phage KC5a     hypothetical protein
gi|226819760 Lactobacillus gasseri MV-22 NCBI   hypothetical protein LgasM_03755
gi|226819824 Lactobacillus gasseri MV-22 NCBI   hypothetical protein LgasM_04089
gi|89891930 Lactobacillus gasseri phage KC5a NCBI   hypothetical protein
gi|90592601 Lactobacillus phage KC5a NCBI   hypothetical protein LGPKV5a_gp26
img|638319699 Lactobacillus gasseri phage KC5a IMG   hypothetical protein
ref|YP_529861.1 Lactobacillus phage KC5a RefSeq   hypothetical protein LGPKV5a_gp26
ref|ZP_03808879.1 Lactobacillus gasseri MV-22 RefSeq   hypothetical protein LgasM_03755
ref|ZP_03808943.1 Lactobacillus gasseri MV-22 RefSeq   hypothetical protein LgasM_04089
tr|Q20DE7 Lactobacillus phage KC5a TrEMBL   Putative uncharacterized protein orf26


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search