The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.13.peg.634: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_008530 from base 642869 to 654047 (11179 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
623 643348 642869 480 -           FIG00742762: hypothetical protein locus|LGAS_0636, protein_id|YP_814468.1, gi|116629296, geneID|4440159
624 643664 643326 339 - -23 4     Cro-like phage transcriptional repressor protein locus|LGAS_0637, protein_id|YP_814469.1, gi|116629297, geneID|4440160
625 643818 644042 225 + 153         XRE family transcriptional regulator locus|LGAS_0638, protein_id|YP_814470.1, gi|116629298, geneID|4440161
626 644075 644410 336 + 32         Phage related protein locus|LGAS_0639, protein_id|YP_814471.1, gi|116629299, geneID|4440162
627 644415 644693 279 + 4         FIG00744823: hypothetical protein locus|LGAS_0640, protein_id|YP_814472.1, gi|116629300, geneID|4440163
628 644811 644957 147 + 117         putative recombination protein locus|LGAS_0641, protein_id|YP_814473.1, gi|116629301, geneID|4440164
629 645060 645341 282 + 102         FIG00743546: hypothetical protein locus|LGAS_0642, protein_id|YP_814474.1, gi|116629302, geneID|4440165
630 645341 646201 861 + -1         FIG00746299: hypothetical protein locus|LGAS_0643, protein_id|YP_814475.1, gi|116629303, geneID|4440166
631 646207 647019 813 + 5         FIG00751630: hypothetical protein locus|LGAS_0644, protein_id|YP_814476.1, gi|116629304, geneID|4440167
632 647029 647952 924 + 9 7     FIG00744143: hypothetical protein locus|LGAS_0645, protein_id|YP_814477.1, gi|116629305, geneID|4440168
633 647958 648263 306 + 5         Transcriptional regulator, xre family locus|LGAS_0646, protein_id|YP_814478.1, gi|116629306, geneID|4440169
634 648256 649041 786 + -8       Phage antirepressor protein locus|LGAS_0647, protein_id|YP_814479.1, gi|116629307, geneID|4440170
635 649056 649241 186 + 14         FIG00749519: hypothetical protein locus|LGAS_0648, protein_id|YP_814480.1, gi|116629308, geneID|4440171
636 649251 649463 213 + 9         FIG00745651: hypothetical protein locus|LGAS_0649, protein_id|YP_814481.1, gi|116629309, geneID|4440172
637 649656 649919 264 + 192         hypothetical protein locus|LGAS_0650, protein_id|YP_814482.1, gi|116629310, geneID|4440173
638 649916 650116 201 + -4         hypothetical protein  
639 650113 650469 357 + -4         FIG00746627: hypothetical protein locus|LGAS_0651, protein_id|YP_814483.1, gi|116629311, geneID|4440141
640 650539 650793 255 + 69         hypothetical protein locus|LGAS_0652, protein_id|YP_814484.1, gi|116629312, geneID|4440142
641 650806 651267 462 + 12         Holliday junction resolvase locus|LGAS_0653, protein_id|YP_814485.1, gi|116629313, geneID|4440143
642 651268 651489 222 + 0         hypothetical protein locus|LGAS_0654, protein_id|YP_814486.1, gi|116629314, geneID|4440144
643 651559 651690 132 + 69         hypothetical protein locus|LGAS_0655, protein_id|YP_814487.1, gi|116629315, geneID|4440145
644 651680 651970 291 + -11         FIG00751351: hypothetical protein locus|LGAS_0656, protein_id|YP_814488.1, gi|116629316, geneID|4440146
645 651973 652191 219 + 2         FIG00754532: hypothetical protein locus|LGAS_0657, protein_id|YP_814489.1, gi|116629317, geneID|4440147
646 652178 652345 168 + -14         hypothetical protein locus|LGAS_0658, protein_id|YP_814490.1, gi|116629318, geneID|4440148
647 652375 652905 531 + 29         FIG00747662: hypothetical protein locus|LGAS_0659, protein_id|YP_814491.1, gi|116629319, geneID|4440149
rna.19 653635 653707 73 + 729         tRNA-Gln-TTG  
648 653763 654047 285 + 55     4: 2 1 3 4   Chromosome (plasmid) partitioning protein ParB locus|LGAS_0661, protein_id|YP_814492.1, gi|116629320, geneID|4440151

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.13.peg.634 Phage antirepressor protein
MNNELIKVTVKNDQQLVSARDLYKGLGIKRRFSAWWEQNSNDFKENSDFQRVLISTPREN
RGSIELQDYALTIDMAKQLCLLSRTSKGKEYREYLIEVEKKWNNPDMIMQRALTIANNRV
KLLETEKRELKETNARQAAKIAKDADDVVFAKAIRYSHHAIPVGELAEILTQNGFVIGRN
QLFQLLREEKYLSSFNHSWNVPMTQMVKRGLFRITHNLTRDGRGYSQTWVTPKGQKYIIN
KALRGKFDDIYQKVMVSTLNV

MD5 = 0fc49e24d0251d824e32c7ef1d404ada


  DNA Sequence

>fig|324831.13.peg.634 Phage antirepressor protein
atgaataacgaattaatcaaagtaacggtcaagaatgaccagcaactagttagtgctaga
gatttatataagggattaggtatcaagcgaagattttccgcttggtgggaacagaacagc
aatgactttaaagaaaatagtgatttccaacgtgtacttataagtacacctagagaaaac
cgcggtagcattgagcttcaggactatgcactcacaattgatatggctaagcagctgtgt
cttttgagccgtacctcaaagggcaaggaatatcgagaatacttaatcgaagttgaaaag
aagtggaataatccggacatgattatgcaacgcgccttaactatcgctaacaatcgggtg
aagttgctggaaactgaaaagagagaactaaaagaaacaaatgctagacaagcagctaag
attgctaaagatgctgacgatgtggtttttgccaaggctattagatatagccatcatgca
atccctgttggcgaattagctgaaattttaactcaaaacggttttgtgattggaagaaat
caactattccaattacttagagaagaaaaatatctttcaagttttaatcatagctggaac
gtgccaatgacacagatggttaaaagaggtctgtttagaattacacataatttgaccaga
gatggcagaggatattctcaaacatgggtaacacctaaaggtcagaaatacattattaac
aaagcgctaagaggaaaatttgatgatatttatcaaaaagttatggtatcaaccttgaac
gtttag


  DNA with Flanking Sequence

>fig|324831.13.peg.634 Phage antirepressor protein
cagaaactctttttggaactaagtttgaagcatatctaaatcagccagatacaggaccta
ttccacgaaacaattttagaaataagccagttcgaagggctacaaactgggataaggttc
agcaacaacaatcgcaaacaacactacaaatgacgcgagaagaacgtaacgcaattttca
gagagtacgggaggtaaccaccatgcaaaataggctaaagaaattgagattggaaaagag
attaactcttgccgatatacaagctaaaaccaacattgattttagaattttagaaaattt
cgaaaaaggattggaaaatggaatacataactctttagcaatttggcaaaagttggctaa
ctttttagaagttccaattgagtacctaatgggattaaacgacgatagcaagacattaac
tgttaacgacttgaacccagccaaagaagatgcttacgagcgtattacggatatgctatg
cgaagatgaggacgatgaagatgaataacgaattaatcaaagtaacggtcaagaatgacc
agcaactagttagtgctagagatttatataagggattaggtatcaagcgaagattttccg
cttggtgggaacagaacagcaatgactttaaagaaaatagtgatttccaacgtgtactta
taagtacacctagagaaaaccgcggtagcattgagcttcaggactatgcactcacaattg
atatggctaagcagctgtgtcttttgagccgtacctcaaagggcaaggaatatcgagaat
acttaatcgaagttgaaaagaagtggaataatccggacatgattatgcaacgcgccttaa
ctatcgctaacaatcgggtgaagttgctggaaactgaaaagagagaactaaaagaaacaa
atgctagacaagcagctaagattgctaaagatgctgacgatgtggtttttgccaaggcta
ttagatatagccatcatgcaatccctgttggcgaattagctgaaattttaactcaaaacg
gttttgtgattggaagaaatcaactattccaattacttagagaagaaaaatatctttcaa
gttttaatcatagctggaacgtgccaatgacacagatggttaaaagaggtctgtttagaa
ttacacataatttgaccagagatggcagaggatattctcaaacatgggtaacacctaaag
gtcagaaatacattattaacaaagcgctaagaggaaaatttgatgatatttatcaaaaag
ttatggtatcaaccttgaacgtttagaaaggactagcacgatgaacgaaattgaaaatat
taaagccggtttgacttatcttttagatattaacgatttgaagaacaatgtaacggtaac
caaagatggcaagtcgcattctatgaatgtgaaagatttgaaagaagcaaattatgatgt
tcttttacaaattgctgaattattaggtatggatgttaataactaggagaacagaatgct
tgaagaaaatcacgatttagagaaaatcatcgaagatgctaaacaatatcgctggtactc
agttcctgatatgtacgtggttgagatcttagacacaacaggtcgctcagctggatatgc
caagtcgatatttatcgacaagaaagaggcagcaaaagttgctaagaagctccatggagt
agtaaggcaggtaagtcaaaatgagtaaaacccagctaaaaccaaagtggtatgcaatgt
atagaggtgacacattcattgatcttggtacagcagattatttagc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.13.peg.573 Lactobacillus gasseri ATCC 33323 FIG   Phage antirepressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|324831.13.peg.624 Cro-like phage transcriptional repressor protein
7 fig|324831.13.peg.632 FIG00744143: hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search