The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.13.peg.632: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: FIG00744143: hypothetical protein
Translate Function Assignments



Context on contig NC_008530 from base 641970 to 652905 (10936 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
621 642107 641970 138 -           FIG00745371: hypothetical protein  
622 642804 642181 624 - 73         lipoprotein, putative locus|LGAS_0635, protein_id|YP_814467.1, gi|116629295, geneID|4440158
623 643348 642869 480 - 64         FIG00742762: hypothetical protein locus|LGAS_0636, protein_id|YP_814468.1, gi|116629296, geneID|4440159
624 643664 643326 339 - -23         Cro-like phage transcriptional repressor protein locus|LGAS_0637, protein_id|YP_814469.1, gi|116629297, geneID|4440160
625 643818 644042 225 + 153         XRE family transcriptional regulator locus|LGAS_0638, protein_id|YP_814470.1, gi|116629298, geneID|4440161
626 644075 644410 336 + 32         Phage related protein locus|LGAS_0639, protein_id|YP_814471.1, gi|116629299, geneID|4440162
627 644415 644693 279 + 4         FIG00744823: hypothetical protein locus|LGAS_0640, protein_id|YP_814472.1, gi|116629300, geneID|4440163
628 644811 644957 147 + 117         putative recombination protein locus|LGAS_0641, protein_id|YP_814473.1, gi|116629301, geneID|4440164
629 645060 645341 282 + 102         FIG00743546: hypothetical protein locus|LGAS_0642, protein_id|YP_814474.1, gi|116629302, geneID|4440165
630 645341 646201 861 + -1         FIG00746299: hypothetical protein locus|LGAS_0643, protein_id|YP_814475.1, gi|116629303, geneID|4440166
631 646207 647019 813 + 5         FIG00751630: hypothetical protein locus|LGAS_0644, protein_id|YP_814476.1, gi|116629304, geneID|4440167
632 647029 647952 924 + 9         FIG00744143: hypothetical protein locus|LGAS_0645, protein_id|YP_814477.1, gi|116629305, geneID|4440168
633 647958 648263 306 + 5         Transcriptional regulator, xre family locus|LGAS_0646, protein_id|YP_814478.1, gi|116629306, geneID|4440169
634 648256 649041 786 + -8         Phage antirepressor protein locus|LGAS_0647, protein_id|YP_814479.1, gi|116629307, geneID|4440170
635 649056 649241 186 + 14         FIG00749519: hypothetical protein locus|LGAS_0648, protein_id|YP_814480.1, gi|116629308, geneID|4440171
636 649251 649463 213 + 9         FIG00745651: hypothetical protein locus|LGAS_0649, protein_id|YP_814481.1, gi|116629309, geneID|4440172
637 649656 649919 264 + 192         hypothetical protein locus|LGAS_0650, protein_id|YP_814482.1, gi|116629310, geneID|4440173
638 649916 650116 201 + -4         hypothetical protein  
639 650113 650469 357 + -4         FIG00746627: hypothetical protein locus|LGAS_0651, protein_id|YP_814483.1, gi|116629311, geneID|4440141
640 650539 650793 255 + 69         hypothetical protein locus|LGAS_0652, protein_id|YP_814484.1, gi|116629312, geneID|4440142
641 650806 651267 462 + 12         Holliday junction resolvase locus|LGAS_0653, protein_id|YP_814485.1, gi|116629313, geneID|4440143
642 651268 651489 222 + 0         hypothetical protein locus|LGAS_0654, protein_id|YP_814486.1, gi|116629314, geneID|4440144
643 651559 651690 132 + 69         hypothetical protein locus|LGAS_0655, protein_id|YP_814487.1, gi|116629315, geneID|4440145
644 651680 651970 291 + -11         FIG00751351: hypothetical protein locus|LGAS_0656, protein_id|YP_814488.1, gi|116629316, geneID|4440146
645 651973 652191 219 + 2         FIG00754532: hypothetical protein locus|LGAS_0657, protein_id|YP_814489.1, gi|116629317, geneID|4440147
646 652178 652345 168 + -14         hypothetical protein locus|LGAS_0658, protein_id|YP_814490.1, gi|116629318, geneID|4440148
647 652375 652905 531 + 29         FIG00747662: hypothetical protein locus|LGAS_0659, protein_id|YP_814491.1, gi|116629319, geneID|4440149

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.13.peg.632 FIG00744143: hypothetical protein
MGRRMYSDKIVETDKFLDMPVSSQNLYWHLCMHADDDGFLGNPKTIVRSIGAQQDDLKIL
VEKGYVIVFEDGVIAITDWFVHNYIPKDRYHETVYKEDKKQLELSETKQYRLVTRKPIVQ
DTKSKQVVDNMDTSCIQDDNKVYTEDKLSKDKLSKDNNIYKLSSSENIDTDPEQKSQKIP
YEKIIDYLNRKTNSHYRPTSKATRRLIKARYNEGFTDIDFKSVIDKKCAEWLQDGNMVQY
LRPETLFGTKFEAYLNQPDTGPIPRNNFRNKPVRRATNWDKVQQQQSQTTLQMTREERNA
IFREYGR

MD5 = ac87785e949f0150aa02fdb2827b4bfc


  DNA Sequence

>fig|324831.13.peg.632 FIG00744143: hypothetical protein
atgggtagaagaatgtacagcgataagattgttgaaactgataaattcttagatatgccc
gtatctagtcaaaatctatattggcacttatgtatgcacgcagatgatgatggattttta
ggaaatcctaaaactatagttagatcaattggtgcacaacaagacgatttaaaaattcta
gttgaaaagggatacgtaattgtatttgaagatggagtaattgctataacagactggttc
gttcataactacattcctaaagatcgctatcatgaaacagtttataaagaagataaaaaa
caacttgagctgtccgaaaccaagcaataccgccttgttacaagaaagccgattgttcag
gatacaaaaagtaaacaagttgtagacaacatggatacatcttgtatacaagatgataac
aaagtgtataccgaagataagttaagtaaagataagttaagtaaagataataatatatat
aaattgtcgagttcagagaacatcgacaccgatccagaacaaaaatctcaaaaaatacct
tacgaaaaaattatcgattacttaaacagaaagactaattcacattatcgtccaacttct
aaagctactaggcgactaattaaagctagatacaacgagggctttactgatattgacttt
aagtctgttatagacaagaagtgtgctgaatggctacaagatggcaacatggttcagtac
ttaagaccagaaactctttttggaactaagtttgaagcatatctaaatcagccagataca
ggacctattccacgaaacaattttagaaataagccagttcgaagggctacaaactgggat
aaggttcagcaacaacaatcgcaaacaacactacaaatgacgcgagaagaacgtaacgca
attttcagagagtacgggaggtaa


  DNA with Flanking Sequence

>fig|324831.13.peg.632 FIG00744143: hypothetical protein
aagtttggtttaaaaactttaatgtgggagacgcacagaaaacagctagcttaatcagtt
atgctaagcgttattccttaagtgcagcttttggaattgctagtgaagatgacgatgatg
cgcaggacgtaaaaaatattgaagagcctaaagtcttatctaaacaagagttagataatt
acacggtttactataacggaattaaagctaatctagctgaattatatcaagaagctgtag
atggaattgctgatgctcaagattggattagaggatcacatactccgcaggacgcccaag
ccatttatcagttaaatcaaagttacaaacggcgtgaaaaagataagcaagaggctttaa
agaaagccgaagaggaagctaaaaaagaagaaaaattaagagaagcacagcgaagtgaag
agaagccaaaacaagaagatgtatccaatttattcggaacattacctgctgacggggaat
acatcaaataggaggtcaaaatgggtagaagaatgtacagcgataagattgttgaaactg
ataaattcttagatatgcccgtatctagtcaaaatctatattggcacttatgtatgcacg
cagatgatgatggatttttaggaaatcctaaaactatagttagatcaattggtgcacaac
aagacgatttaaaaattctagttgaaaagggatacgtaattgtatttgaagatggagtaa
ttgctataacagactggttcgttcataactacattcctaaagatcgctatcatgaaacag
tttataaagaagataaaaaacaacttgagctgtccgaaaccaagcaataccgccttgtta
caagaaagccgattgttcaggatacaaaaagtaaacaagttgtagacaacatggatacat
cttgtatacaagatgataacaaagtgtataccgaagataagttaagtaaagataagttaa
gtaaagataataatatatataaattgtcgagttcagagaacatcgacaccgatccagaac
aaaaatctcaaaaaataccttacgaaaaaattatcgattacttaaacagaaagactaatt
cacattatcgtccaacttctaaagctactaggcgactaattaaagctagatacaacgagg
gctttactgatattgactttaagtctgttatagacaagaagtgtgctgaatggctacaag
atggcaacatggttcagtacttaagaccagaaactctttttggaactaagtttgaagcat
atctaaatcagccagatacaggacctattccacgaaacaattttagaaataagccagttc
gaagggctacaaactgggataaggttcagcaacaacaatcgcaaacaacactacaaatga
cgcgagaagaacgtaacgcaattttcagagagtacgggaggtaaccaccatgcaaaatag
gctaaagaaattgagattggaaaagagattaactcttgccgatatacaagctaaaaccaa
cattgattttagaattttagaaaatttcgaaaaaggattggaaaatggaatacataactc
tttagcaatttggcaaaagttggctaactttttagaagttccaattgagtacctaatggg
attaaacgacgatagcaagacattaactgttaacgacttgaacccagccaaagaagatgc
ttacgagcgtattacggatatgctatgcgaagatgaggacgatgaagatgaataacgaat
taatcaaagtaacggtcaagaatgaccagcaactagttagtgctagagatttatataagg
gattaggtatcaagcgaagattttccgcttggtgggaacagaacagcaatgactttaaag
aaaatagtgatttccaacgtgtacttataagtacacctagagaaaaccgcggtagcattg
agct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.10.peg.555 Lactobacillus gasseri ATCC 33323 FIG   FIG00744143: hypothetical protein
fig|324831.10.peg.606 Lactobacillus gasseri ATCC 33323 FIG   FIG00744143: hypothetical protein
fig|324831.13.peg.571 Lactobacillus gasseri ATCC 33323 FIG   FIG00744143: hypothetical protein
gb|ABJ59979.1 Lactobacillus gasseri ATCC 33323     hypothetical protein LGAS_0583
gb|ABJ60039.1 Lactobacillus gasseri ATCC 33323     hypothetical protein LGAS_0645
gi|116094827 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0583
gi|116094887 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0645
gi|116629245 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0583
gi|116629305 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0645
img|639672440 Lactobacillus gasseri ATCC 33323 IMG   hypothetical protein
img|639672502 Lactobacillus gasseri ATCC 33323 IMG   hypothetical protein
kegg|lga:LGAS_0583 Lactobacillus gasseri ATCC 33323 KEGG   hypothetical protein
kegg|lga:LGAS_0645 Lactobacillus gasseri ATCC 33323 KEGG   hypothetical protein
ref|YP_814417.1 Lactobacillus gasseri ATCC 33323 RefSeq   hypothetical protein LGAS_0583
ref|YP_814477.1 Lactobacillus gasseri ATCC 33323 RefSeq   hypothetical protein LGAS_0645
tr|Q044T3 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search