The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.13.peg.626: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: Phage related protein
Translate Function Assignments



Context on contig NC_008530 from base 638784 to 649463 (10680 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
618 638784 639215 432 +           FIG00746951: hypothetical protein locus|LGAS_0631, protein_id|YP_814463.1, gi|116629291, geneID|4440189
619 639225 640157 933 + 9         Phage lysin, 1,4-beta-N-acetylmuramidase (EC 3.2.1.17) or lysozyme locus|LGAS_0632, protein_id|YP_814464.1, gi|116629292, geneID|4440190
620 641967 640849 1119 - 691         Mobile element protein locus|LGAS_0634, protein_id|YP_814466.1, gi|116629294, geneID|4440157
621 642107 641970 138 - 2         FIG00745371: hypothetical protein  
622 642804 642181 624 - 73         lipoprotein, putative locus|LGAS_0635, protein_id|YP_814467.1, gi|116629295, geneID|4440158
623 643348 642869 480 - 64         FIG00742762: hypothetical protein locus|LGAS_0636, protein_id|YP_814468.1, gi|116629296, geneID|4440159
624 643664 643326 339 - -23         Cro-like phage transcriptional repressor protein locus|LGAS_0637, protein_id|YP_814469.1, gi|116629297, geneID|4440160
625 643818 644042 225 + 153         XRE family transcriptional regulator locus|LGAS_0638, protein_id|YP_814470.1, gi|116629298, geneID|4440161
626 644075 644410 336 + 32         Phage related protein locus|LGAS_0639, protein_id|YP_814471.1, gi|116629299, geneID|4440162
627 644415 644693 279 + 4         FIG00744823: hypothetical protein locus|LGAS_0640, protein_id|YP_814472.1, gi|116629300, geneID|4440163
628 644811 644957 147 + 117         putative recombination protein locus|LGAS_0641, protein_id|YP_814473.1, gi|116629301, geneID|4440164
629 645060 645341 282 + 102         FIG00743546: hypothetical protein locus|LGAS_0642, protein_id|YP_814474.1, gi|116629302, geneID|4440165
630 645341 646201 861 + -1         FIG00746299: hypothetical protein locus|LGAS_0643, protein_id|YP_814475.1, gi|116629303, geneID|4440166
631 646207 647019 813 + 5         FIG00751630: hypothetical protein locus|LGAS_0644, protein_id|YP_814476.1, gi|116629304, geneID|4440167
632 647029 647952 924 + 9         FIG00744143: hypothetical protein locus|LGAS_0645, protein_id|YP_814477.1, gi|116629305, geneID|4440168
633 647958 648263 306 + 5         Transcriptional regulator, xre family locus|LGAS_0646, protein_id|YP_814478.1, gi|116629306, geneID|4440169
634 648256 649041 786 + -8         Phage antirepressor protein locus|LGAS_0647, protein_id|YP_814479.1, gi|116629307, geneID|4440170
635 649056 649241 186 + 14         FIG00749519: hypothetical protein locus|LGAS_0648, protein_id|YP_814480.1, gi|116629308, geneID|4440171
636 649251 649463 213 + 9         FIG00745651: hypothetical protein locus|LGAS_0649, protein_id|YP_814481.1, gi|116629309, geneID|4440172

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.13.peg.626 Phage related protein
MPELINKDALIVIFKPIIKALFDKEKEEAEGATINIDEFRKKYCGGKGQEWVRLYVFDKF
KKEIDFENGGFVVNPHNGKKTIIFRKDAKKWIEENYHRIDWNASIKKDFGR

MD5 = 1fb8349b920000238b66cc4745098e9d


  DNA Sequence

>fig|324831.13.peg.626 Phage related protein
atgcctgagctaattaataaagatgctctcatagttatctttaagccgattatcaaagct
ttatttgataaggaaaaggaagaagcagagggcgcaacaattaacattgatgagttccga
aaaaagtattgcggaggtaaaggtcaagagtgggtaaggttgtatgttttcgataagttt
aaaaaggaaattgatttcgaaaatggtggttttgtagttaacccacacaacggcaagaaa
acaatcatttttagaaaagacgctaaaaagtggattgaagaaaactatcaccgcattgat
tggaatgcaagtattaagaaagattttgggaggtag


  DNA with Flanking Sequence

>fig|324831.13.peg.626 Phage related protein
agtttgttgagatacatgtaataatttgcttagttctgtttgtgagagtctatgagatgt
cctcaactcacgtattctatcgccaatcatgctcttcaacctccgtttatcaactattgt
acttaaattataatactttatacatatttttaacttaaaaagtaaaaaaagtagtaaaaa
gtgtttacattataaactatgatgtatataatatatatgtaagttgataaaggagttgat
aaaatgaagcgggaacttaaaagcttacgagttggagctgggcttacgcaaactgaatta
gcaaagcgattaggcgttactaatgttacagtttcaaggtgggagagaggagaagcaatt
ccaaagcccaagtatattaaagccatggcaaaattatttaatatcaaggggcaggatatt
tttttaaatttaattactactaaagcttataaagttgctacaaaatagaaacaaatagtg
ataataaagtaggtgattaaatgcctgagctaattaataaagatgctctcatagttatct
ttaagccgattatcaaagctttatttgataaggaaaaggaagaagcagagggcgcaacaa
ttaacattgatgagttccgaaaaaagtattgcggaggtaaaggtcaagagtgggtaaggt
tgtatgttttcgataagtttaaaaaggaaattgatttcgaaaatggtggttttgtagtta
acccacacaacggcaagaaaacaatcatttttagaaaagacgctaaaaagtggattgaag
aaaactatcaccgcattgattggaatgcaagtattaagaaagattttgggaggtagaaaa
atgataaaggttacaacgggcgatgtaattagacaattggtatcaagaggcgtattcgag
tggaagaaagatgctgaatatcagattggcatcaaagatgaacagattgttgttaacaaa
gatggatcggctgaaattgcctatctaggtaacaccttagaaagtgttattcagttagcc
gatatgtttaaaaaggtaggtactaaggaacagcaagagcaaattaacgcagcacttaca
gatttagtaacgattggagatcgctggaatgaagcgtaagaagacagattggctggttgc
aattgtgtgttcagaagtaattgcagcaggggttatatgtatcactatgttgggctatta
cttctggagaatattcctttaaaggaggtgggatagatgacattagaagcaagattaatc
agcaatagcaacgcattttttgctagacaagataagtcaccactagatgttgatgagtac
cagaaacaattcgaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.10.peg.550 Lactobacillus gasseri ATCC 33323 FIG   Phage related protein
fig|324831.10.peg.601 Lactobacillus gasseri ATCC 33323 FIG   Phage related protein
fig|324831.13.peg.565 Lactobacillus gasseri ATCC 33323 FIG   Phage related protein
fig|363555.2.peg.6 Siphoviridae Lactobacillus phage KC5a FIG   Phage related protein
gb|ABD78783.1 Lactobacillus gasseri phage KC5a     hypothetical protein
gb|ABJ59973.1 Lactobacillus gasseri ATCC 33323     Phage related protein
gb|ABJ60033.1 Lactobacillus gasseri ATCC 33323     Phage related protein
gi|116094821 Lactobacillus gasseri ATCC 33323 NCBI   Phage related protein
gi|116094881 Lactobacillus gasseri ATCC 33323 NCBI   Phage related protein
gi|116629239 Lactobacillus gasseri ATCC 33323 NCBI   Phage related protein
gi|116629299 Lactobacillus gasseri ATCC 33323 NCBI   Phage related protein
gi|89891910 Lactobacillus gasseri phage KC5a NCBI   hypothetical protein
gi|90592581 Lactobacillus phage KC5a NCBI   hypothetical protein LGPKV5a_gp06
img|638319679 Lactobacillus gasseri phage KC5a IMG   hypothetical protein
img|639672434 Lactobacillus gasseri ATCC 33323 IMG   Phage related protein
img|639672496 Lactobacillus gasseri ATCC 33323 IMG   Phage related protein
kegg|lga:LGAS_0577 Lactobacillus gasseri ATCC 33323 KEGG   phage related protein
kegg|lga:LGAS_0639 Lactobacillus gasseri ATCC 33323 KEGG   phage related protein
ref|YP_529841.1 Lactobacillus phage KC5a RefSeq   hypothetical protein LGPKV5a_gp06
ref|YP_814411.1 Lactobacillus gasseri ATCC 33323 RefSeq   Phage related protein
ref|YP_814471.1 Lactobacillus gasseri ATCC 33323 RefSeq   Phage related protein
tr|Q044T9 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243) TrEMBL   Phage related protein
tr|Q20DG7 Lactobacillus phage KC5a TrEMBL   Putative uncharacterized protein orf6


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search