The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.10.peg.616: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: Chromosome (plasmid) partitioning protein ParB
Translate Function Assignments



Context on contig NC_008530 from base 648205 to 659975 (11771 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
608 648205 649041 837 +       1: 1 cwh Phage antirepressor protein LGAS_0647, YP_814479.1, gi|116629307, GeneID:4440170
609 649056 649241 186 + 14         FIG00749519: hypothetical protein LGAS_0648, YP_814480.1, gi|116629308, GeneID:4440171
610 649251 649463 213 + 9         FIG00745651: hypothetical protein LGAS_0649, YP_814481.1, gi|116629309, GeneID:4440172
611 650098 650469 372 + 634         FIG00746627: hypothetical protein LGAS_0651, YP_814483.1, gi|116629311, GeneID:4440141
612 650806 651267 462 + 336         Holliday junction resolvase LGAS_0653, YP_814485.1, gi|116629313, GeneID:4440143
613 651268 651489 222 + 0         hypothetical protein LGAS_0654, YP_814486.1, gi|116629314, GeneID:4440144
614 651635 651970 336 + 145         FIG00751351: hypothetical protein LGAS_0656, YP_814488.1, gi|116629316, GeneID:4440146
615 652375 652905 531 + 404         FIG00747662: hypothetical protein LGAS_0659, YP_814491.1, gi|116629319, GeneID:4440149
rna.19 653635 653707 73 + 729         tRNA-Gln-TTG tRNA-Gln-TTG
616 653763 654047 285 + 55         Chromosome (plasmid) partitioning protein ParB LGAS_0661, YP_814492.1, gi|116629320, GeneID:4440151
rna.20 654299 654380 82 + 251         tRNA-Pseudo-??? tRNA-Pseudo-???
617 654488 655105 618 + 107         hypothetical protein LGAS_0663, YP_814493.1, gi|116629321, GeneID:4440153
618 655288 655944 657 + 182         Phage terminase, large subunit LGAS_0664, YP_814494.1, gi|116629322, GeneID:4440154
619 656173 656526 354 + 228         Phage terminase, small subunit LGAS_0665, YP_814495.1, gi|116629323, GeneID:4440155
620 656615 657346 732 + 88     1: 1   HNH homing endonuclease # Phage intron LGAS_0666, YP_814496.1, gi|116629324, GeneID:4440156
621 657349 658572 1224 + 2         Phage terminase, large subunit LGAS_0667, YP_814497.1, gi|116629325, GeneID:4440124
622 658644 659975 1332 + 71       cwn Phage portal protein LGAS_0668, YP_814498.1, gi|116629326, GeneID:4440125

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.10.peg.616 Chromosome (plasmid) partitioning protein ParB
MKVETVSINKIKPYENNPRNNDDAVDAVANSIKEFGWQQPIVVDNGGVIIAGHTRYKAAK
KLGYKEVPIVVADSFDYWQRFNNCEPIVDLHKYK

MD5 = befa0c1134bcdb5f475a3ea727042114


  DNA Sequence

>fig|324831.10.peg.616 Chromosome (plasmid) partitioning protein ParB
atgaaagttgagacagtttcaattaataagattaaaccttatgagaacaaccctagaaat
aatgatgatgcagttgacgctgtagctaattctattaaggaatttggctggcaacagccc
atagttgtcgataatgggggggtaatcatagctggtcatacacggtacaaggctgctaag
aaattgggctataaagaagttccaattgtggttgcagatagcttcgattactggcaaagg
tttaataactgtgaacctattgttgatcttcataaatataagtaa


  DNA with Flanking Sequence

>fig|324831.10.peg.616 Chromosome (plasmid) partitioning protein ParB
gttcgaatcctgattgcttgatagcctaggcggtagtccattattggctattgtatataa
tagttgcctaggtaaatgacgcctatgccatgaccctcaacggtttcgaggagagcgtgg
gaagagctggggcgttgttggctggcccgcagcagcaactgccgtgggtagagtggcaca
atttggaatttagaaagaaaagaggaattttctttcacaactatgtagcggggttcaatt
cctcgcctgcccattgcctgtcggaaagcaggcgtaaaaataatattatttagatcacga
atatattttgtttgtctgattttaatttacagaattgcatctggtttagctctgtaccta
acagagcattctaggactatagccaaattggtaaggcatcaggttttgatcctgtgtatt
gttggttcgagcccagctagtcctatagattagctcgttttttgttttatagtgtttatt
tcaaggaataggagttaagtatgaaagttgagacagtttcaattaataagattaaacctt
atgagaacaaccctagaaataatgatgatgcagttgacgctgtagctaattctattaagg
aatttggctggcaacagcccatagttgtcgataatgggggggtaatcatagctggtcata
cacggtacaaggctgctaagaaattgggctataaagaagttccaattgtggttgcagata
gcttcgattactggcaaaggtttaataactgtgaacctattgttgatcttcataaatata
agtaagggtactttgaaggtataattatggtacttcaatagtctttaggtatggttaaat
atatattgtgagttaatgaaaattaattcaccgcattaatagaattcctctctatattta
tgtatttaacatttaggctattgctctgtgttagctgcgcatacatgcattctttaagaa
tgtcctttaagagcataattatgattagctttagttttgaaatgcttagttttaagccac
taaggctaatctttatagcaacttagttcaatgggagaacaaagcgtgtacagttaaaca
atgtgcttgagaaggtggttcgattccatcagttgctgtagtcctttttaggactaaata
attccattcgtttcaaaaagtcaagtcttttaattaggcttgacttttttataattattt
ttgaaacgaatggaggctaaataaaatgaatgtttttacaaataatattattgatggtta
tataagatggaataaaaacaatatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
fig|324831.10.peg.565 Lactobacillus gasseri ATCC 33323 FIG   Chromosome (plasmid) partitioning protein ParB
fig|324831.13.peg.587 Lactobacillus gasseri ATCC 33323 FIG   Chromosome (plasmid) partitioning protein ParB
fig|324831.13.peg.648 Lactobacillus gasseri ATCC 33323 FIG   Chromosome (plasmid) partitioning protein ParB
gb|ABJ59994.1 Lactobacillus gasseri ATCC 33323     ParB-like nuclease domain
gb|ABJ60054.1 Lactobacillus gasseri ATCC 33323     ParB-like nuclease domain
gi|116094842 Lactobacillus gasseri ATCC 33323 NCBI   ParB-like nuclease domain
gi|116094902 Lactobacillus gasseri ATCC 33323 NCBI   ParB-like nuclease domain
gi|116629260 Lactobacillus gasseri ATCC 33323 NCBI   ParB-like nuclease domain-containing protein
gi|116629320 Lactobacillus gasseri ATCC 33323 NCBI   ParB-like nuclease domain-containing protein
img|639672456 Lactobacillus gasseri ATCC 33323 IMG   ParB-like nuclease domain
img|639672518 Lactobacillus gasseri ATCC 33323 IMG   ParB-like nuclease domain
kegg|lga:LGAS_0599 Lactobacillus gasseri ATCC 33323 KEGG   ParB-like nuclease domain-containing protein
kegg|lga:LGAS_0661 Lactobacillus gasseri ATCC 33323 KEGG   ParB-like nuclease domain-containing protein
ref|YP_814432.1 Lactobacillus gasseri ATCC 33323 RefSeq   ParB-like nuclease domain-containing protein
ref|YP_814492.1 Lactobacillus gasseri ATCC 33323 RefSeq   ParB-like nuclease domain-containing protein
tr|Q044R8 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243) TrEMBL   ParB-like nuclease domain


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search