The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.10.peg.610: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: FIG00745651: hypothetical protein
Translate Function Assignments



Context on contig NC_008530 from base 644075 to 654380 (10306 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
601 644075 644410 336 +           Phage related protein LGAS_0639, YP_814471.1, gi|116629299, GeneID:4440162
602 644379 644693 315 + -32         FIG00744823: hypothetical protein LGAS_0640, YP_814472.1, gi|116629300, GeneID:4440163
603 645009 645341 333 + 315         FIG00743546: hypothetical protein LGAS_0642, YP_814474.1, gi|116629302, GeneID:4440165
604 645341 646201 861 + -1         FIG00746299: hypothetical protein LGAS_0643, YP_814475.1, gi|116629303, GeneID:4440166
605 646207 647019 813 + 5         FIG00751630: hypothetical protein LGAS_0644, YP_814476.1, gi|116629304, GeneID:4440167
606 647029 647952 924 + 9         FIG00744143: hypothetical protein LGAS_0645, YP_814477.1, gi|116629305, GeneID:4440168
607 647958 648263 306 + 5         Transcriptional regulator, xre family LGAS_0646, YP_814478.1, gi|116629306, GeneID:4440169
608 648205 649041 837 + -59     1: 1 cwh Phage antirepressor protein LGAS_0647, YP_814479.1, gi|116629307, GeneID:4440170
609 649056 649241 186 + 14         FIG00749519: hypothetical protein LGAS_0648, YP_814480.1, gi|116629308, GeneID:4440171
610 649251 649463 213 + 9         FIG00745651: hypothetical protein LGAS_0649, YP_814481.1, gi|116629309, GeneID:4440172
611 650098 650469 372 + 634         FIG00746627: hypothetical protein LGAS_0651, YP_814483.1, gi|116629311, GeneID:4440141
612 650806 651267 462 + 336         Holliday junction resolvase LGAS_0653, YP_814485.1, gi|116629313, GeneID:4440143
613 651268 651489 222 + 0         hypothetical protein LGAS_0654, YP_814486.1, gi|116629314, GeneID:4440144
614 651635 651970 336 + 145         FIG00751351: hypothetical protein LGAS_0656, YP_814488.1, gi|116629316, GeneID:4440146
615 652375 652905 531 + 404         FIG00747662: hypothetical protein LGAS_0659, YP_814491.1, gi|116629319, GeneID:4440149
rna.19 653635 653707 73 + 729         tRNA-Gln-TTG tRNA-Gln-TTG
616 653763 654047 285 + 55         Chromosome (plasmid) partitioning protein ParB LGAS_0661, YP_814492.1, gi|116629320, GeneID:4440151
rna.20 654299 654380 82 + 251         tRNA-Pseudo-??? tRNA-Pseudo-???

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.10.peg.610 FIG00745651: hypothetical protein
MLEENHDLEKIIEDAKQYRWYSVPDMYVVEILDTTGRSAGYAKSIFIDKKEAAKVAKKLH
GVVRQVSQNE

MD5 = 6afbccc966b8f3ce6d23463263289c9a


  DNA Sequence

>fig|324831.10.peg.610 FIG00745651: hypothetical protein
atgcttgaagaaaatcacgatttagagaaaatcatcgaagatgctaaacaatatcgctgg
tactcagttcctgatatgtacgtggttgagatcttagacacaacaggtcgctcagctgga
tatgccaagtcgatatttatcgacaagaaagaggcagcaaaagttgctaagaagctccat
ggagtagtaaggcaggtaagtcaaaatgagtaa


  DNA with Flanking Sequence

>fig|324831.10.peg.610 FIG00745651: hypothetical protein
ttagctgaaattttaactcaaaacggttttgtgattggaagaaatcaactattccaatta
cttagagaagaaaaatatctttcaagttttaatcatagctggaacgtgccaatgacacag
atggttaaaagaggtctgtttagaattacacataatttgaccagagatggcagaggatat
tctcaaacatgggtaacacctaaaggtcagaaatacattattaacaaagcgctaagagga
aaatttgatgatatttatcaaaaagttatggtatcaaccttgaacgtttagaaaggacta
gcacgatgaacgaaattgaaaatattaaagccggtttgacttatcttttagatattaacg
atttgaagaacaatgtaacggtaaccaaagatggcaagtcgcattctatgaatgtgaaag
atttgaaagaagcaaattatgatgttcttttacaaattgctgaattattaggtatggatg
ttaataactaggagaacagaatgcttgaagaaaatcacgatttagagaaaatcatcgaag
atgctaaacaatatcgctggtactcagttcctgatatgtacgtggttgagatcttagaca
caacaggtcgctcagctggatatgccaagtcgatatttatcgacaagaaagaggcagcaa
aagttgctaagaagctccatggagtagtaaggcaggtaagtcaaaatgagtaaaacccag
ctaaaaccaaagtggtatgcaatgtatagaggtgacacattcattgatcttggtacagca
gattatttagctgaaaagtatcacaaaaagaaacaatctctgttgtacttgtcgaaacct
gcatatcacagaaacgcatcgaaaaatagtcaaagattaacactgtacaaaatggaggat
taacaatggaaattattgataatcgcacaaagaaagaagagtggcgcttgggtgatgtac
ttgtatctgggagcgctcaattaacaggcttaattgtaaaagataacaatggaaaatatt
gcttaatagatattactcctgacgaatctggaaactacagcaccatggaaggttgttact
atggcgatagttgtgaaaatttagcagaactttattgcaaaatgggtcccaattggcaca
aagtaaacgcaaagctggtgatcgaatgacagtagcaactagagaaaaatgtccatattg
tcagggcgtaaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.10.peg.559 Lactobacillus gasseri ATCC 33323 FIG   FIG00745651: hypothetical protein
fig|324831.13.peg.575 Lactobacillus gasseri ATCC 33323 FIG   FIG00745651: hypothetical protein
fig|324831.13.peg.636 Lactobacillus gasseri ATCC 33323 FIG   FIG00745651: hypothetical protein
gb|ABJ59983.1 Lactobacillus gasseri ATCC 33323     hypothetical protein LGAS_0587
gb|ABJ60043.1 Lactobacillus gasseri ATCC 33323     hypothetical protein LGAS_0649
gi|116094831 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0587
gi|116094891 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0649
gi|116629249 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0587
gi|116629309 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0649
img|639672444 Lactobacillus gasseri ATCC 33323 IMG   hypothetical protein
img|639672506 Lactobacillus gasseri ATCC 33323 IMG   hypothetical protein
kegg|lga:LGAS_0587 Lactobacillus gasseri ATCC 33323 KEGG   hypothetical protein
kegg|lga:LGAS_0649 Lactobacillus gasseri ATCC 33323 KEGG   hypothetical protein
ref|YP_814421.1 Lactobacillus gasseri ATCC 33323 RefSeq   hypothetical protein LGAS_0587
ref|YP_814481.1 Lactobacillus gasseri ATCC 33323 RefSeq   hypothetical protein LGAS_0649
tr|Q044S9 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search