The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.10.peg.608: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_008530 from base 642869 to 654047 (11179 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
598 643351 642869 483 -           FIG00742762: hypothetical protein LGAS_0636, YP_814468.1, gi|116629296, GeneID:4440159
599 643664 643326 339 - -26       cwn Cro-like phage transcriptional repressor protein LGAS_0637, YP_814469.1, gi|116629297, GeneID:4440160
600 643818 644042 225 + 153         XRE family transcriptional regulator LGAS_0638, YP_814470.1, gi|116629298, GeneID:4440161
601 644075 644410 336 + 32         Phage related protein LGAS_0639, YP_814471.1, gi|116629299, GeneID:4440162
602 644379 644693 315 + -32         FIG00744823: hypothetical protein LGAS_0640, YP_814472.1, gi|116629300, GeneID:4440163
603 645009 645341 333 + 315         FIG00743546: hypothetical protein LGAS_0642, YP_814474.1, gi|116629302, GeneID:4440165
604 645341 646201 861 + -1         FIG00746299: hypothetical protein LGAS_0643, YP_814475.1, gi|116629303, GeneID:4440166
605 646207 647019 813 + 5         FIG00751630: hypothetical protein LGAS_0644, YP_814476.1, gi|116629304, GeneID:4440167
606 647029 647952 924 + 9 5     FIG00744143: hypothetical protein LGAS_0645, YP_814477.1, gi|116629305, GeneID:4440168
607 647958 648263 306 + 5         Transcriptional regulator, xre family LGAS_0646, YP_814478.1, gi|116629306, GeneID:4440169
608 648205 649041 837 + -59   1: 1 cwh Phage antirepressor protein LGAS_0647, YP_814479.1, gi|116629307, GeneID:4440170
609 649056 649241 186 + 14         FIG00749519: hypothetical protein LGAS_0648, YP_814480.1, gi|116629308, GeneID:4440171
610 649251 649463 213 + 9         FIG00745651: hypothetical protein LGAS_0649, YP_814481.1, gi|116629309, GeneID:4440172
611 650098 650469 372 + 634         FIG00746627: hypothetical protein LGAS_0651, YP_814483.1, gi|116629311, GeneID:4440141
612 650806 651267 462 + 336         Holliday junction resolvase LGAS_0653, YP_814485.1, gi|116629313, GeneID:4440143
613 651268 651489 222 + 0         hypothetical protein LGAS_0654, YP_814486.1, gi|116629314, GeneID:4440144
614 651635 651970 336 + 145         FIG00751351: hypothetical protein LGAS_0656, YP_814488.1, gi|116629316, GeneID:4440146
615 652375 652905 531 + 404         FIG00747662: hypothetical protein LGAS_0659, YP_814491.1, gi|116629319, GeneID:4440149
rna.19 653635 653707 73 + 729         tRNA-Gln-TTG tRNA-Gln-TTG
616 653763 654047 285 + 55         Chromosome (plasmid) partitioning protein ParB LGAS_0661, YP_814492.1, gi|116629320, GeneID:4440151

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Phage_experimental RamyA Phage antirepressor protein


  Protein Sequence

>fig|324831.10.peg.608 Phage antirepressor protein
MLTSVLRICYAKMRTMKMNNELIKVTVKNDQQLVSARDLYKGLGIKRRFSAWWEQNSNDF
KENSDFQRVLISTPRENRGSIELQDYALTIDMAKQLCLLSRTSKGKEYREYLIEVEKKWN
NPDMIMQRALTIANNRVKLLETEKRELKETNARQAAKIAKDADDVVFAKAIRYSHHAIPV
GELAEILTQNGFVIGRNQLFQLLREEKYLSSFNHSWNVPMTQMVKRGLFRITHNLTRDGR
GYSQTWVTPKGQKYIINKALRGKFDDIYQKVMVSTLNV

MD5 = f694fe1f3d23a8997eaaf13c01a0a1a8


  DNA Sequence

>fig|324831.10.peg.608 Phage antirepressor protein
atgcttacgagcgtattacggatatgctatgcgaagatgaggacgatgaagatgaataac
gaattaatcaaagtaacggtcaagaatgaccagcaactagttagtgctagagatttatat
aagggattaggtatcaagcgaagattttccgcttggtgggaacagaacagcaatgacttt
aaagaaaatagtgatttccaacgtgtacttataagtacacctagagaaaaccgcggtagc
attgagcttcaggactatgcactcacaattgatatggctaagcagctgtgtcttttgagc
cgtacctcaaagggcaaggaatatcgagaatacttaatcgaagttgaaaagaagtggaat
aatccggacatgattatgcaacgcgccttaactatcgctaacaatcgggtgaagttgctg
gaaactgaaaagagagaactaaaagaaacaaatgctagacaagcagctaagattgctaaa
gatgctgacgatgtggtttttgccaaggctattagatatagccatcatgcaatccctgtt
ggcgaattagctgaaattttaactcaaaacggttttgtgattggaagaaatcaactattc
caattacttagagaagaaaaatatctttcaagttttaatcatagctggaacgtgccaatg
acacagatggttaaaagaggtctgtttagaattacacataatttgaccagagatggcaga
ggatattctcaaacatgggtaacacctaaaggtcagaaatacattattaacaaagcgcta
agaggaaaatttgatgatatttatcaaaaagttatggtatcaaccttgaacgtttag


  DNA with Flanking Sequence

>fig|324831.10.peg.608 Phage antirepressor protein
agaagtgtgctgaatggctacaagatggcaacatggttcagtacttaagaccagaaactc
tttttggaactaagtttgaagcatatctaaatcagccagatacaggacctattccacgaa
acaattttagaaataagccagttcgaagggctacaaactgggataaggttcagcaacaac
aatcgcaaacaacactacaaatgacgcgagaagaacgtaacgcaattttcagagagtacg
ggaggtaaccaccatgcaaaataggctaaagaaattgagattggaaaagagattaactct
tgccgatatacaagctaaaaccaacattgattttagaattttagaaaatttcgaaaaagg
attggaaaatggaatacataactctttagcaatttggcaaaagttggctaactttttaga
agttccaattgagtacctaatgggattaaacgacgatagcaagacattaactgttaacga
cttgaacccagccaaagaagatgcttacgagcgtattacggatatgctatgcgaagatga
ggacgatgaagatgaataacgaattaatcaaagtaacggtcaagaatgaccagcaactag
ttagtgctagagatttatataagggattaggtatcaagcgaagattttccgcttggtggg
aacagaacagcaatgactttaaagaaaatagtgatttccaacgtgtacttataagtacac
ctagagaaaaccgcggtagcattgagcttcaggactatgcactcacaattgatatggcta
agcagctgtgtcttttgagccgtacctcaaagggcaaggaatatcgagaatacttaatcg
aagttgaaaagaagtggaataatccggacatgattatgcaacgcgccttaactatcgcta
acaatcgggtgaagttgctggaaactgaaaagagagaactaaaagaaacaaatgctagac
aagcagctaagattgctaaagatgctgacgatgtggtttttgccaaggctattagatata
gccatcatgcaatccctgttggcgaattagctgaaattttaactcaaaacggttttgtga
ttggaagaaatcaactattccaattacttagagaagaaaaatatctttcaagttttaatc
atagctggaacgtgccaatgacacagatggttaaaagaggtctgtttagaattacacata
atttgaccagagatggcagaggatattctcaaacatgggtaacacctaaaggtcagaaat
acattattaacaaagcgctaagaggaaaatttgatgatatttatcaaaaagttatggtat
caaccttgaacgtttagaaaggactagcacgatgaacgaaattgaaaatattaaagccgg
tttgacttatcttttagatattaacgatttgaagaacaatgtaacggtaaccaaagatgg
caagtcgcattctatgaatgtgaaagatttgaaagaagcaaattatgatgttcttttaca
aattgctgaattattaggtatggatgttaataactaggagaacagaatgcttgaagaaaa
tcacgatttagagaaaatcatcgaagatgctaaacaatatcgctggtactcagttcctga
tatgtacgtggttgagatcttagacacaacaggtcgctcagctggatatgccaagtcgat
atttatcgacaagaaagaggcagcaaaagttgctaagaagctccatggagtagtaaggca
ggtaagtcaaaatgagtaaaacccagctaaaaccaaagtggtatgcaatgtatagaggtg
acacattcattgatcttggtacagcagattatttagc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.10.peg.557 Lactobacillus gasseri ATCC 33323 FIG   Phage antirepressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|324831.10.peg.606 FIG00744143: hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code cwh


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search