The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.10.peg.607: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: Transcriptional regulator, xre family
Translate Function Assignments



Context on contig NC_008530 from base 642869 to 652905 (10037 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
598 643351 642869 483 -           FIG00742762: hypothetical protein LGAS_0636, YP_814468.1, gi|116629296, GeneID:4440159
599 643664 643326 339 - -26       cwn Cro-like phage transcriptional repressor protein LGAS_0637, YP_814469.1, gi|116629297, GeneID:4440160
600 643818 644042 225 + 153         XRE family transcriptional regulator LGAS_0638, YP_814470.1, gi|116629298, GeneID:4440161
601 644075 644410 336 + 32         Phage related protein LGAS_0639, YP_814471.1, gi|116629299, GeneID:4440162
602 644379 644693 315 + -32         FIG00744823: hypothetical protein LGAS_0640, YP_814472.1, gi|116629300, GeneID:4440163
603 645009 645341 333 + 315         FIG00743546: hypothetical protein LGAS_0642, YP_814474.1, gi|116629302, GeneID:4440165
604 645341 646201 861 + -1         FIG00746299: hypothetical protein LGAS_0643, YP_814475.1, gi|116629303, GeneID:4440166
605 646207 647019 813 + 5         FIG00751630: hypothetical protein LGAS_0644, YP_814476.1, gi|116629304, GeneID:4440167
606 647029 647952 924 + 9         FIG00744143: hypothetical protein LGAS_0645, YP_814477.1, gi|116629305, GeneID:4440168
607 647958 648263 306 + 5         Transcriptional regulator, xre family LGAS_0646, YP_814478.1, gi|116629306, GeneID:4440169
608 648205 649041 837 + -59     1: 1 cwh Phage antirepressor protein LGAS_0647, YP_814479.1, gi|116629307, GeneID:4440170
609 649056 649241 186 + 14         FIG00749519: hypothetical protein LGAS_0648, YP_814480.1, gi|116629308, GeneID:4440171
610 649251 649463 213 + 9         FIG00745651: hypothetical protein LGAS_0649, YP_814481.1, gi|116629309, GeneID:4440172
611 650098 650469 372 + 634         FIG00746627: hypothetical protein LGAS_0651, YP_814483.1, gi|116629311, GeneID:4440141
612 650806 651267 462 + 336         Holliday junction resolvase LGAS_0653, YP_814485.1, gi|116629313, GeneID:4440143
613 651268 651489 222 + 0         hypothetical protein LGAS_0654, YP_814486.1, gi|116629314, GeneID:4440144
614 651635 651970 336 + 145         FIG00751351: hypothetical protein LGAS_0656, YP_814488.1, gi|116629316, GeneID:4440146
615 652375 652905 531 + 404         FIG00747662: hypothetical protein LGAS_0659, YP_814491.1, gi|116629319, GeneID:4440149

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.10.peg.607 Transcriptional regulator, xre family
MQNRLKKLRLEKRLTLADIQAKTNIDFRILENFEKGLENGIHNSLAIWQKLANFLEVPIE
YLMGLNDDSKTLTVNDLNPAKEDAYERITDMLCEDEDDEDE

MD5 = 3a06eae08b06d61eb0348bc53f33af61


  DNA Sequence

>fig|324831.10.peg.607 Transcriptional regulator, xre family
atgcaaaataggctaaagaaattgagattggaaaagagattaactcttgccgatatacaa
gctaaaaccaacattgattttagaattttagaaaatttcgaaaaaggattggaaaatgga
atacataactctttagcaatttggcaaaagttggctaactttttagaagttccaattgag
tacctaatgggattaaacgacgatagcaagacattaactgttaacgacttgaacccagcc
aaagaagatgcttacgagcgtattacggatatgctatgcgaagatgaggacgatgaagat
gaataa


  DNA with Flanking Sequence

>fig|324831.10.peg.607 Transcriptional regulator, xre family
accgaagataagttaagtaaagataagttaagtaaagataataatatatataaattgtcg
agttcagagaacatcgacaccgatccagaacaaaaatctcaaaaaataccttacgaaaaa
attatcgattacttaaacagaaagactaattcacattatcgtccaacttctaaagctact
aggcgactaattaaagctagatacaacgagggctttactgatattgactttaagtctgtt
atagacaagaagtgtgctgaatggctacaagatggcaacatggttcagtacttaagacca
gaaactctttttggaactaagtttgaagcatatctaaatcagccagatacaggacctatt
ccacgaaacaattttagaaataagccagttcgaagggctacaaactgggataaggttcag
caacaacaatcgcaaacaacactacaaatgacgcgagaagaacgtaacgcaattttcaga
gagtacgggaggtaaccaccatgcaaaataggctaaagaaattgagattggaaaagagat
taactcttgccgatatacaagctaaaaccaacattgattttagaattttagaaaatttcg
aaaaaggattggaaaatggaatacataactctttagcaatttggcaaaagttggctaact
ttttagaagttccaattgagtacctaatgggattaaacgacgatagcaagacattaactg
ttaacgacttgaacccagccaaagaagatgcttacgagcgtattacggatatgctatgcg
aagatgaggacgatgaagatgaataacgaattaatcaaagtaacggtcaagaatgaccag
caactagttagtgctagagatttatataagggattaggtatcaagcgaagattttccgct
tggtgggaacagaacagcaatgactttaaagaaaatagtgatttccaacgtgtacttata
agtacacctagagaaaaccgcggtagcattgagcttcaggactatgcactcacaattgat
atggctaagcagctgtgtcttttgagccgtacctcaaagggcaaggaatatcgagaatac
ttaatcgaagttgaaaagaagtggaataatccggacatgattatgcaacgcgccttaact
atcgctaacaatcgggtgaagttgctggaaactgaaaagagagaactaaaagaaacaaat
gctagacaagcagctaagattgctaaagatgctgacgatgtggtttttgccaaggctatt
agatatagccatcatgcaatccctgttggcgaattagctgaaattt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0043565       F:sequence-specific DNA binding
fig|324831.10.peg.556 Lactobacillus gasseri ATCC 33323 FIG   Transcriptional regulator, xre family
fig|324831.13.peg.572 Lactobacillus gasseri ATCC 33323 FIG   Transcriptional regulator, xre family
fig|324831.13.peg.633 Lactobacillus gasseri ATCC 33323 FIG   Transcriptional regulator, xre family
gb|ABJ59980.1 Lactobacillus gasseri ATCC 33323     Transcriptional regulator, xre family
gb|ABJ60040.1 Lactobacillus gasseri ATCC 33323     Transcriptional regulator, xre family
gi|116094828 Lactobacillus gasseri ATCC 33323 NCBI   Transcriptional regulator, xre family
gi|116094888 Lactobacillus gasseri ATCC 33323 NCBI   Transcriptional regulator, xre family
gi|116629246 Lactobacillus gasseri ATCC 33323 NCBI   XRE family transcriptional regulator
gi|116629306 Lactobacillus gasseri ATCC 33323 NCBI   XRE family transcriptional regulator
img|639672441 Lactobacillus gasseri ATCC 33323 IMG   Transcriptional regulator, xre family
img|639672503 Lactobacillus gasseri ATCC 33323 IMG   Transcriptional regulator, xre family
kegg|lga:LGAS_0584 Lactobacillus gasseri ATCC 33323 KEGG   XRE family transcriptional regulator
kegg|lga:LGAS_0646 Lactobacillus gasseri ATCC 33323 KEGG   XRE family transcriptional regulator
ref|YP_814418.1 Lactobacillus gasseri ATCC 33323 RefSeq   XRE family transcriptional regulator
ref|YP_814478.1 Lactobacillus gasseri ATCC 33323 RefSeq   XRE family transcriptional regulator
tr|Q044T2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243) TrEMBL   Transcriptional regulator, xre family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search