The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.10.peg.604: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: FIG00746299: hypothetical protein
Translate Function Assignments



Context on contig NC_008530 from base 640849 to 651267 (10419 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
595 641967 640849 1119 -         cwn Mobile element protein LGAS_0634, YP_814466.1, gi|116629294, GeneID:4440157
596 642116 641970 147 - 2         FIG00745371: hypothetical protein  
597 642804 642181 624 - 64         lipoprotein, putative LGAS_0635, YP_814467.1, gi|116629295, GeneID:4440158
598 643351 642869 483 - 64         FIG00742762: hypothetical protein LGAS_0636, YP_814468.1, gi|116629296, GeneID:4440159
599 643664 643326 339 - -26       cwn Cro-like phage transcriptional repressor protein LGAS_0637, YP_814469.1, gi|116629297, GeneID:4440160
600 643818 644042 225 + 153         XRE family transcriptional regulator LGAS_0638, YP_814470.1, gi|116629298, GeneID:4440161
601 644075 644410 336 + 32         Phage related protein LGAS_0639, YP_814471.1, gi|116629299, GeneID:4440162
602 644379 644693 315 + -32         FIG00744823: hypothetical protein LGAS_0640, YP_814472.1, gi|116629300, GeneID:4440163
603 645009 645341 333 + 315         FIG00743546: hypothetical protein LGAS_0642, YP_814474.1, gi|116629302, GeneID:4440165
604 645341 646201 861 + -1         FIG00746299: hypothetical protein LGAS_0643, YP_814475.1, gi|116629303, GeneID:4440166
605 646207 647019 813 + 5         FIG00751630: hypothetical protein LGAS_0644, YP_814476.1, gi|116629304, GeneID:4440167
606 647029 647952 924 + 9         FIG00744143: hypothetical protein LGAS_0645, YP_814477.1, gi|116629305, GeneID:4440168
607 647958 648263 306 + 5         Transcriptional regulator, xre family LGAS_0646, YP_814478.1, gi|116629306, GeneID:4440169
608 648205 649041 837 + -59     1: 1 cwh Phage antirepressor protein LGAS_0647, YP_814479.1, gi|116629307, GeneID:4440170
609 649056 649241 186 + 14         FIG00749519: hypothetical protein LGAS_0648, YP_814480.1, gi|116629308, GeneID:4440171
610 649251 649463 213 + 9         FIG00745651: hypothetical protein LGAS_0649, YP_814481.1, gi|116629309, GeneID:4440172
611 650098 650469 372 + 634         FIG00746627: hypothetical protein LGAS_0651, YP_814483.1, gi|116629311, GeneID:4440141
612 650806 651267 462 + 336         Holliday junction resolvase LGAS_0653, YP_814485.1, gi|116629313, GeneID:4440143

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.10.peg.604 FIG00746299: hypothetical protein
MKEISTKLDETSPDYKVKFTPASIEFDDYGKLKEETDEIYKRYNGYVVVPENLKGDRAIA
ADLNKKAKALKAAKSTVRKQALKPLDEFNEQMDALIDEITDVSGQIHQGLKDYREQGIKL
RHEANIKHIDKMAEKFGLTHEDIAYDAKWDNKSNNWKKIEENINQLLEKAAQERDFKNEK
ITLITEAAEKEQILPDSYINLIDDLTISEILARIKNDGKRQRELSLKKDEPIKQQVKGNS
VIDTTTGEVVGETKVAYLKITGSDEQMKKLVEFIKSQGLKVEPIER

MD5 = 9cb4fb57ea18cef8e4059fe42ab70ed4


  DNA Sequence

>fig|324831.10.peg.604 FIG00746299: hypothetical protein
atgaaagaaatttcaacaaaattagatgaaactagtcctgattataaagttaaatttact
ccagcctcaattgagtttgacgattatggaaagcttaaagaagagacagatgaaatatat
aagagatataacggctatgttgttgttcctgaaaatctaaaaggggatagagcaattgct
gctgatttaaataaaaaagctaaggctttaaaggctgctaaaagtactgttagaaagcaa
gcattaaaacccttagatgagttcaatgagcagatggacgccttaattgatgagattaca
gatgtttctggtcaaattcatcaaggattgaaggactatagagagcaaggtattaagtta
agacacgaagctaatattaagcacatcgacaaaatggctgaaaagtttggtcttactcat
gaagatatagcctatgacgctaaatgggataacaagtctaataactggaagaagattgaa
gaaaacatcaatcaacttttagaaaaggcagcacaagaacgtgatttcaaaaatgaaaaa
atcactttaattacagaagctgctgaaaaagagcaaattttaccagatagttatatcaat
ttgattgatgatctaactatttctgaaatattagctcgaattaagaatgatggaaaacgt
caaagagaactaagtttaaaaaaagatgagcctatcaagcaacaagttaaaggcaattca
gtaattgatacgactactggagaagtagttggcgaaacaaaagttgcttatctaaaaatt
actggatcagatgaacagatgaaaaagttagtcgaatttataaaaagtcaaggattaaaa
gtagaaccaattgagaggtaa


  DNA with Flanking Sequence

>fig|324831.10.peg.604 FIG00746299: hypothetical protein
agcaacgcattttttgctagacaagataagtcaccactagatgttgatgagtaccagaaa
caattcgaaattgctttaatgcaacaaaaaaagccgttaccgactgcaaatcagtaacga
ctaatcaaaggttttataaattaaattactaaggagtattttaccacaatggtcgaaatt
atgacacccgtacaagctgccacttatagagagcagcgattgaaaaaagaacaaagaaat
ttagcaaaacaaggtattagttcagcaatggaaggcaaaagccttgtaaccattggtgat
gcaaatcaggattatttaagttttaaacatttcgttacagctcaaatttttagattgggt
atcgatacttatatgggtcttacaggttgggacgacaaaagagaattaattgaagagctt
gccagtgtagaagatcccaatgatgatctttggaaagaggatgtactagattattttgac
ggatttgaggggaactactgatgaaagaaatttcaacaaaattagatgaaactagtcctg
attataaagttaaatttactccagcctcaattgagtttgacgattatggaaagcttaaag
aagagacagatgaaatatataagagatataacggctatgttgttgttcctgaaaatctaa
aaggggatagagcaattgctgctgatttaaataaaaaagctaaggctttaaaggctgcta
aaagtactgttagaaagcaagcattaaaacccttagatgagttcaatgagcagatggacg
ccttaattgatgagattacagatgtttctggtcaaattcatcaaggattgaaggactata
gagagcaaggtattaagttaagacacgaagctaatattaagcacatcgacaaaatggctg
aaaagtttggtcttactcatgaagatatagcctatgacgctaaatgggataacaagtcta
ataactggaagaagattgaagaaaacatcaatcaacttttagaaaaggcagcacaagaac
gtgatttcaaaaatgaaaaaatcactttaattacagaagctgctgaaaaagagcaaattt
taccagatagttatatcaatttgattgatgatctaactatttctgaaatattagctcgaa
ttaagaatgatggaaaacgtcaaagagaactaagtttaaaaaaagatgagcctatcaagc
aacaagttaaaggcaattcagtaattgatacgactactggagaagtagttggcgaaacaa
aagttgcttatctaaaaattactggatcagatgaacagatgaaaaagttagtcgaattta
taaaaagtcaaggattaaaagtagaaccaattgagaggtaataaagatggagtttgtcgg
agaagtaaaagatcgtgcaagttgggcattacacttcgcacaagttaaagctaatatcaa
acaaccacaaagaagtcataaggttcaagtatcaggaaaaactaaaactggtaagcctta
tacgtatgaatacaagtatgcagacttagcagacgttgataaatcagttatggaagccac
taaaaaagttgttgatgataaaggcaatgtacagtttacttacttttttgatgttaacaa
cacggatcaaggtgtagatgtacaaaccattctagtagatgtatctggcttttatgctgt
cacaaataaagtttggtttaaaaactttaatgtgggagacgcacagaaaacagctagctt
aatcagttatgctaagcgttattccttaagtgcagcttttggaattgctagtgaagatga
cgatgatgcgcaggacgtaaaaaatattgaagagcctaaagtcttatctaaacaagagtt
a


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.10.peg.553 Lactobacillus gasseri ATCC 33323 FIG   FIG00746299: hypothetical protein
fig|324831.13.peg.569 Lactobacillus gasseri ATCC 33323 FIG   FIG00746299: hypothetical protein
fig|324831.13.peg.630 Lactobacillus gasseri ATCC 33323 FIG   FIG00746299: hypothetical protein
gb|ABJ59977.1 Lactobacillus gasseri ATCC 33323     hypothetical protein LGAS_0581
gb|ABJ60037.1 Lactobacillus gasseri ATCC 33323     hypothetical protein LGAS_0643
gi|116094825 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0581
gi|116094885 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0643
gi|116629243 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0581
gi|116629303 Lactobacillus gasseri ATCC 33323 NCBI   hypothetical protein LGAS_0643
img|639672438 Lactobacillus gasseri ATCC 33323 IMG   hypothetical protein
img|639672500 Lactobacillus gasseri ATCC 33323 IMG   hypothetical protein
kegg|lga:LGAS_0581 Lactobacillus gasseri ATCC 33323 KEGG   hypothetical protein
kegg|lga:LGAS_0643 Lactobacillus gasseri ATCC 33323 KEGG   hypothetical protein
ref|YP_814415.1 Lactobacillus gasseri ATCC 33323 RefSeq   hypothetical protein LGAS_0581
ref|YP_814475.1 Lactobacillus gasseri ATCC 33323 RefSeq   hypothetical protein LGAS_0643
tr|Q044T5 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search