The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|324831.10.peg.599: Lactobacillus gasseri ATCC 33323

This feature in The SEED Viewer

NCBI Taxonomy Id: 324831

Current Assignment: Cro-like phage transcriptional repressor protein
Translate Function Assignments



Context on contig NC_008530 from base 638049 to 649041 (10993 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
591 638049 638498 450 +           FIG00746437: hypothetical protein LGAS_0629, YP_814461.1, gi|116629289, GeneID:4440187
592 638509 638787 279 + 10       ff FIG00747293: hypothetical protein LGAS_0630, YP_814462.1, gi|116629290, GeneID:4440188
593 638784 639215 432 + -4       ff FIG00746951: hypothetical protein LGAS_0631, YP_814463.1, gi|116629291, GeneID:4440189
594 639225 640157 933 + 9         Phage lysin, 1,4-beta-N-acetylmuramidase (EC 3.2.1.17) or lysozyme LGAS_0632, YP_814464.1, gi|116629292, GeneID:4440190
595 641967 640849 1119 - 691 4   cwn Mobile element protein LGAS_0634, YP_814466.1, gi|116629294, GeneID:4440157
596 642116 641970 147 - 2         FIG00745371: hypothetical protein  
597 642804 642181 624 - 64         lipoprotein, putative LGAS_0635, YP_814467.1, gi|116629295, GeneID:4440158
598 643351 642869 483 - 64         FIG00742762: hypothetical protein LGAS_0636, YP_814468.1, gi|116629296, GeneID:4440159
599 643664 643326 339 - -26     cwn Cro-like phage transcriptional repressor protein LGAS_0637, YP_814469.1, gi|116629297, GeneID:4440160
600 643818 644042 225 + 153         XRE family transcriptional regulator LGAS_0638, YP_814470.1, gi|116629298, GeneID:4440161
601 644075 644410 336 + 32         Phage related protein LGAS_0639, YP_814471.1, gi|116629299, GeneID:4440162
602 644379 644693 315 + -32         FIG00744823: hypothetical protein LGAS_0640, YP_814472.1, gi|116629300, GeneID:4440163
603 645009 645341 333 + 315         FIG00743546: hypothetical protein LGAS_0642, YP_814474.1, gi|116629302, GeneID:4440165
604 645341 646201 861 + -1         FIG00746299: hypothetical protein LGAS_0643, YP_814475.1, gi|116629303, GeneID:4440166
605 646207 647019 813 + 5         FIG00751630: hypothetical protein LGAS_0644, YP_814476.1, gi|116629304, GeneID:4440167
606 647029 647952 924 + 9 4     FIG00744143: hypothetical protein LGAS_0645, YP_814477.1, gi|116629305, GeneID:4440168
607 647958 648263 306 + 5         Transcriptional regulator, xre family LGAS_0646, YP_814478.1, gi|116629306, GeneID:4440169
608 648205 649041 837 + -59 6 1: 1 cwh Phage antirepressor protein LGAS_0647, YP_814479.1, gi|116629307, GeneID:4440170

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|324831.10.peg.599 Cro-like phage transcriptional repressor protein
MIGDRIRELRTSHRLSQTELSKLLHVSQQTITKWENGKAEPSSGALAKLAEYFDVSADYL
LGSDKTSEPKSVDLEKDPVVLSYGGRPVSEEDMDVIKAILERHKNDGDVHYE

MD5 = 11afcee4a537884e87bb5d4ed40695a6


  DNA Sequence

>fig|324831.10.peg.599 Cro-like phage transcriptional repressor protein
atgattggcgatagaatacgtgagttgaggacatctcatagactctcacaaacagaacta
agcaaattattacatgtatctcaacaaactattactaaatgggaaaatgggaaagctgag
ccttcaagcggtgctttagctaaactagctgaatactttgatgtgtcagctgattattta
ttaggttcagataaaactagtgagcctaaatccgttgacctagaaaaagatcctgtcgtt
cttagttacggtggacgccctgtttcagaagaagatatggacgttatcaaagcaattctt
gaaagacataagaatgatggagacgttcactacgagtaa


  DNA with Flanking Sequence

>fig|324831.10.peg.599 Cro-like phage transcriptional repressor protein
ctctgcttcttccttttccttatcaaataaagctttgataatcggcttaaagataactat
gagagcatctttattaattagctcaggcatttaatcacctactttattatcactatttgt
ttctattttgtagcaactttataagctttagtagtaattaaatttaaaaaaatatcctgc
cccttgatattaaataattttgccatggctttaatatacttgggctttggaattgcttct
cctctctcccaccttgaaactgtaacattagtaacgcctaatcgctttgctaattcagtt
tgcgtaagcccagctccaactcgtaagcttttaagttcccgcttcattttatcaactcct
ttatcaacttacatatatattatatacatcatagtttataatgtaaacactttttactac
tttttttactttttaagttaaaaatatgtataaagtattataatttaagtacaatagttg
ataaacggaggttgaagagcatgattggcgatagaatacgtgagttgaggacatctcata
gactctcacaaacagaactaagcaaattattacatgtatctcaacaaactattactaaat
gggaaaatgggaaagctgagccttcaagcggtgctttagctaaactagctgaatactttg
atgtgtcagctgattatttattaggttcagataaaactagtgagcctaaatccgttgacc
tagaaaaagatcctgtcgttcttagttacggtggacgccctgtttcagaagaagatatgg
acgttatcaaagcaattcttgaaagacataagaatgatggagacgttcactacgagtaat
gccatgtacaataatgatttgctaatctatatttgtaatttaattgaagatcatcatctt
tcttacatactatcccgcttagaagacagacatttccgttctaggtatcttcctaaacaa
aaaactatcattattaatacaaactggtggaatccaccagaaattccattcatggctgct
cacgaattagggcattatataaatggcgataaaggtgttatgtactatgaccatacttat
aaatggcaagaacatcgtgcttttaatcgcaatgatgatgcttttaaggaagatcaagct
gatctatatggattagatctcatctggaattatgcttcttcccaaggatatacctgtgaa
gaccctggagaatttatgctacagtttggaattcctgagagattgaaaaaagtggttgcc
caaaaatttgaaagcaataatgacttactattttaacctttatagtccaagactgatgac
ttaaaaagctgatgttaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|324831.10.peg.548 Lactobacillus gasseri ATCC 33323 FIG   Cro-like phage transcriptional repressor protein
fig|324831.13.peg.563 Lactobacillus gasseri ATCC 33323 FIG   Cro-like phage transcriptional repressor protein
fig|324831.13.peg.624 Lactobacillus gasseri ATCC 33323 FIG   Cro-like phage transcriptional repressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|324831.10.peg.595 Mobile element protein
4 fig|324831.10.peg.606 FIG00744143: hypothetical protein
6 fig|324831.10.peg.608 Phage antirepressor protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code cwn


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search