The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|323097.6.peg.3325: Nitrobacter hamburgensis X14

This feature in The SEED Viewer

NCBI Taxonomy Id: 323097

Current Assignment: FIG003573: hypothetical protein
Translate Function Assignments



Context on contig NC_007964 from base 2669068 to 2680616 (11549 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3319 2669068 2669724 657 +           Uncharacterized phage-encoded protein-like locus|Nham_2408, protein_id|YP_577659.1, gi|92117930, geneID|4030621
3320 2669721 2670050 330 + -4         hypothetical protein locus|Nham_2409, protein_id|YP_577660.1, gi|92117931, geneID|4030622
3321 2670121 2670261 141 + 70         hypothetical protein  
3322 2670288 2671010 723 + 26         hypothetical protein locus|Nham_2410, protein_id|YP_577661.1, gi|92117932, geneID|4030623
3323 2671013 2671603 591 + 2         hypothetical protein locus|Nham_2411, protein_id|YP_577662.1, gi|92117933, geneID|4030624
3324 2672132 2673097 966 + 528         phage integrase locus|Nham_2413, protein_id|YP_577663.1, gi|92117934, InterPro:IPR002104, geneID|4030626
3325 2673810 2674796 987 + 712       FIG003573: hypothetical protein locus|Nham_2414, protein_id|YP_577664.1, gi|92117935, geneID|4030627
3326 2674839 2675447 609 + 42 7 3: 4 7 6   LSU ribosomal protein L9p gene_name|rplI, locus|Nham_2415, protein_id|YP_577665.1, gi|92117936, InterPro:IPR000244, geneID|4030628
3327 2677993 2675690 2304 - 242     4: 3 1 2 5   ATP-dependent Clp protease ATP-binding subunit ClpA locus|Nham_2416, protein_id|YP_577666.1, gi|92117937, InterPro:IPR001270, InterPro:IPR003593, InterPro:IPR003959, InterPro:IPR004176, InterPro:IPR013093, geneID|4030629
3328 2677997 2678122 126 + 3         hypothetical protein  
3329 2678762 2678349 414 - 226     3: 3 1 2   ATP-dependent Clp protease adaptor protein ClpS locus|Nham_2417, protein_id|YP_577667.1, gi|92117938, InterPro:IPR003769, geneID|4030630
3330 2679270 2680616 1347 + 507         FIG00854202: hypothetical protein locus|Nham_2418, protein_id|YP_577668.1, gi|92117939, geneID|4030361

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|323097.6.peg.3325 FIG003573: hypothetical protein
MIRNLLIAVAAGCASALMFASIISGALVSLLLFYLAPLPLMVAAMGWGPTCAAIGGALAG
AGLGGIFGPSYSAAFVLTVALPAWWLGHLVLLGRPVTADAPQHGTGAAPAGPPPVDWYPL
GRILIWIACFAALTTTAALLTLGSDASTIADTLRRGLQHIVNVQDAASRDRSSEFVDAFV
AIAPAAAATIAMTTLTLNVWLAAKVTATSGRLRRPWPDMKTTTLPPMALVATTVALALCF
VGGLPAMLAQIVTACLMMAYALVGFAVLHTITLAQRGRTLWLACIYAVVLVFVWPLITMV
GIGIGDAIFGFRQRYLQRHMPPPLAPKS

MD5 = 2ff3e236d0a607fdec10d5f56e7120ce


  DNA Sequence

>fig|323097.6.peg.3325 FIG003573: hypothetical protein
atgatcagaaaccttctcattgcagttgcagccggctgcgcgtcggcgctgatgttcgcc
tcgatcatttcgggagcgctcgtctcactgctgctgttctatctggccccactgccgctg
atggtcgcggcgatgggatggggaccgacctgcgcggcgatcggcggcgctctggccggc
gccgggctcggcggcatcttcggcccgtcctattccgccgccttcgtgttgaccgtcgca
ctaccggcgtggtggctcgggcacctggtcctgctcggccgccctgtcacggccgatgcg
ccgcagcacggcaccggcgcggctccggccgggccgccgcctgttgactggtatccactc
ggacgcattctgatctggatcgcgtgcttcgccgccctgaccacgaccgccgcgctgctc
acgctcggttccgacgcatcgacgattgcggatacgctgcgccgcggattgcagcacatt
gtcaatgtgcaggatgcggcgtcacgcgatcgcagctcggagttcgtcgatgcgtttgtg
gccatcgctcccgccgcagccgcaacgatcgcgatgacgacgctgacgctcaacgtgtgg
ctcgcggccaaggtcaccgccacctctggccggctgcgacgcccctggcctgatatgaaa
acaacaacgctcccgccaatggcgctggttgcgacgaccgtggctctggcgctgtgcttc
gtcggcggactgccggccatgctggcccagatcgtcaccgcgtgcctgatgatggcgtat
gcgctcgtgggtttcgccgtactgcacacgatcacgctcgcgcaacgcggccgcacgctg
tggctcgcctgcatctacgccgtcgtgctggtgttcgtctggcccctcatcacgatggtc
ggcatcggcatcggcgacgcgattttcggatttcgccaacgctacctgcaacggcacatg
cctccgccgctcgcacctaaatcgtga


  DNA with Flanking Sequence

>fig|323097.6.peg.3325 FIG003573: hypothetical protein
gcttggcgggagccgctgctctcagtcatcgatggttaccaggggacggtcgatgatgag
gctataacgtcgctaatttagtacagttcctaacaaatcaggagtgtggaccaacaatcg
gatcaaaacttcagaggattagtccggcggcttcagctcgccagcattttgagcaggtca
gttgctcggtggaaatgaccgtcctgccgcgttcagtgacgttcccgttacttctttggg
tctggctccgtcaatatttgaatcggactgcgcatgcgtccgcgcgtagaaaccctcgcc
tgtacctccgccaatgaagttgatccgccgggcaagatgccctacaagccgccatggccc
cgtagggggccatgaacatttcaggggtgtttctggtacggtaactggtacggaccaccc
cctcagaactctaaatagttggttcggctgcgatatttcgctgaccgcaatctaaccgct
cgaaaggagcgggacagctgatgatcagaaaccttctcattgcagttgcagccggctgcg
cgtcggcgctgatgttcgcctcgatcatttcgggagcgctcgtctcactgctgctgttct
atctggccccactgccgctgatggtcgcggcgatgggatggggaccgacctgcgcggcga
tcggcggcgctctggccggcgccgggctcggcggcatcttcggcccgtcctattccgccg
ccttcgtgttgaccgtcgcactaccggcgtggtggctcgggcacctggtcctgctcggcc
gccctgtcacggccgatgcgccgcagcacggcaccggcgcggctccggccgggccgccgc
ctgttgactggtatccactcggacgcattctgatctggatcgcgtgcttcgccgccctga
ccacgaccgccgcgctgctcacgctcggttccgacgcatcgacgattgcggatacgctgc
gccgcggattgcagcacattgtcaatgtgcaggatgcggcgtcacgcgatcgcagctcgg
agttcgtcgatgcgtttgtggccatcgctcccgccgcagccgcaacgatcgcgatgacga
cgctgacgctcaacgtgtggctcgcggccaaggtcaccgccacctctggccggctgcgac
gcccctggcctgatatgaaaacaacaacgctcccgccaatggcgctggttgcgacgaccg
tggctctggcgctgtgcttcgtcggcggactgccggccatgctggcccagatcgtcaccg
cgtgcctgatgatggcgtatgcgctcgtgggtttcgccgtactgcacacgatcacgctcg
cgcaacgcggccgcacgctgtggctcgcctgcatctacgccgtcgtgctggtgttcgtct
ggcccctcatcacgatggtcggcatcggcatcggcgacgcgattttcggatttcgccaac
gctacctgcaacggcacatgcctccgccgctcgcacctaaatcgtgaattcaacgcaaac
ccgctcaactccgaacaaggggatcgaacatggaagtcattctgctggaacgcgtggcca
agctcggccagatgggcgatgtcgtgaaggtgaagcacggtttcgcccgcaacttccttc
tcaaacgcggcaaggccctgcgtgcgaccgccgagaatcgaaccaaatacgacggcatga
aagccgaacttgaaatcaacaacatcaaggccaagggcgaagccgccaaagtcgccgaga
agatcgacggccgcgacatcgtcatcatccgccaggcgtccgagaccggtcagctatttg
gctcggtcacggtacgcgacatcgtggccgcgctggccgaggacggcatcactgtcagcc
gcccacaggtctggctcgatgcgccgatcaagacgatcggtcagcagaagctgacggtcg
cggtccatccggaggtggaagcccatgtcatggtgaccgtcgcccgcagcgccgacgaag
ccgagcg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01NH2911 Nitrobacter hamburgensis X14     membrane protein, putative
fig|323097.3.peg.3090 Nitrobacter hamburgensis X14 FIG   FIG003573: hypothetical protein
gb|ABE63204.1 Nitrobacter hamburgensis X14     conserved hypothetical protein
gi|91800829 Nitrobacter hamburgensis X14 NCBI   conserved hypothetical protein
gi|92117935 Nitrobacter hamburgensis X14 NCBI   hypothetical protein Nham_2414
img|637970873 Nitrobacter hamburgensis X14 IMG   hypothetical protein
kegg|nha:Nham_2414 Nitrobacter hamburgensis X14 KEGG   hypothetical protein
ref|YP_577664.1 Nitrobacter hamburgensis X14 RefSeq   hypothetical protein Nham_2414
tr|Q1QKP3 Nitrobacter hamburgensis (strain X14 / DSM 10229) TrEMBL   Putative uncharacterized protein precursor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|323097.6.peg.3326 LSU ribosomal protein L9p


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search