The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|323097.6.peg.3322: Nitrobacter hamburgensis X14

This feature in The SEED Viewer

NCBI Taxonomy Id: 323097

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_007964 from base 2665560 to 2677993 (12434 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3316 2665560 2666222 663 +           Phage repressor protein cI locus|Nham_2405, protein_id|YP_577656.1, gi|92117927, InterPro:IPR006198, geneID|4030618
3317 2666770 2667285 516 + 547         FIG00853276: hypothetical protein locus|Nham_2406, protein_id|YP_577657.1, gi|92117928, geneID|4030619
3318 2668471 2668010 462 - 724         hypothetical protein locus|Nham_2407, protein_id|YP_577658.1, gi|92117929, geneID|4030620
3319 2669068 2669724 657 + 596         Uncharacterized phage-encoded protein-like locus|Nham_2408, protein_id|YP_577659.1, gi|92117930, geneID|4030621
3320 2669721 2670050 330 + -4         hypothetical protein locus|Nham_2409, protein_id|YP_577660.1, gi|92117931, geneID|4030622
3321 2670121 2670261 141 + 70         hypothetical protein  
3322 2670288 2671010 723 + 26         hypothetical protein locus|Nham_2410, protein_id|YP_577661.1, gi|92117932, geneID|4030623
3323 2671013 2671603 591 + 2         hypothetical protein locus|Nham_2411, protein_id|YP_577662.1, gi|92117933, geneID|4030624
3324 2672132 2673097 966 + 528         phage integrase locus|Nham_2413, protein_id|YP_577663.1, gi|92117934, InterPro:IPR002104, geneID|4030626
3325 2673810 2674796 987 + 712         FIG003573: hypothetical protein locus|Nham_2414, protein_id|YP_577664.1, gi|92117935, geneID|4030627
3326 2674839 2675447 609 + 42     3: 1 7 4   LSU ribosomal protein L9p gene_name|rplI, locus|Nham_2415, protein_id|YP_577665.1, gi|92117936, InterPro:IPR000244, geneID|4030628
3327 2677993 2675690 2304 - 242     4: 6 2 5 3   ATP-dependent Clp protease ATP-binding subunit ClpA locus|Nham_2416, protein_id|YP_577666.1, gi|92117937, InterPro:IPR001270, InterPro:IPR003593, InterPro:IPR003959, InterPro:IPR004176, InterPro:IPR013093, geneID|4030629

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|323097.6.peg.3322 hypothetical protein
MLQLPQRPAETVPCPQVAKPAGVDAVDAIFGTTPAGFDLNNQPIPMLVYWLKKARAKVDG
ITADALTAGEYSEADLAAAMTPFNQIFDAIVNAECNSASDVAWQVQAVVDYLDCLETDSI
EEAVDATQFRKIAANLKRATAFRQPKKIPGKASKGRRLTRAGLLQRYQSFLIEELFTLSC
ELYGDPQYALQYVLFDDAVHKALKTGTRKRTDVFLDSVSLTSRARSVLKSLKIDTENVGR

MD5 = 85312185bbb23e3a0104988831cbd5d9


  DNA Sequence

>fig|323097.6.peg.3322 hypothetical protein
atgcttcagcttccacaaagaccggctgagactgtcccttgtccgcaagtcgccaaaccg
gccggtgtcgatgcagtcgatgcgatcttcggcacaacgccggctggcttcgacctgaac
aaccagcccattccgatgctggtctattggctgaaaaaggccagagcgaaagtggacggg
atcacagcggatgcgctcacagcgggcgaatattccgaagctgatctggctgctgcgatg
acgcccttcaatcagattttcgacgccattgtgaatgctgagtgcaactcggcttctgac
gttgcatggcaagtgcaggctgtcgtggactaccttgactgtctcgagaccgacagcatc
gaggaagcggttgatgcaactcagtttcggaaaatcgcggccaacctgaagcgcgccacg
gcttttcggcaaccgaagaagattccgggtaaagcctcaaagggacggcggttaacgcgc
gcggggttactacagcgatatcagtcttttctaatcgaggaacttttcactctgagctgc
gagctctatggcgatccacaatatgcgctgcaatacgttttattcgatgacgcggtgcac
aaggccctcaaaacagggacgcgcaaacgaactgacgtttttctggattccgttagcctg
acttcacgcgctcgatcggtcttgaagtccctcaaaatcgacactgagaatgtggggcgc
tga


  DNA with Flanking Sequence

>fig|323097.6.peg.3322 hypothetical protein
atgcggcgatgtgcggccttagacgccgtagaacgccgtcccgaaagaacccgctgtatg
tgccgccgacaccggcagacgctgcatggacccacgtctatggcacggcgcgtgcattcg
tggaatgggcgaccgacgcaaacatcaacctcgcgaccaccggcctgcgcgaacgggatg
acagccaggcgtcgaatatccgcgcggttcgggactgcgccaacatcttccgcgcgctcg
tggagcagatcgatgctcaataggcgcgtcgcgaattttaccgagcttgtttggtccacg
gtcggcaatagcgctcctgtcgataagcgcaggatggagcttctgggtgcaaggggcgtc
agcaggtttacaccgtcggtggaaacctcccacaagggcgccgcgttgatcgtcgccatc
gccctcttcatttcaaccgccgcactctggtccgcaatcttctgcggagcgtgatcggcg
cgtccgatcggagaacagcaatgcttcagcttccacaaagaccggctgagactgtccctt
gtccgcaagtcgccaaaccggccggtgtcgatgcagtcgatgcgatcttcggcacaacgc
cggctggcttcgacctgaacaaccagcccattccgatgctggtctattggctgaaaaagg
ccagagcgaaagtggacgggatcacagcggatgcgctcacagcgggcgaatattccgaag
ctgatctggctgctgcgatgacgcccttcaatcagattttcgacgccattgtgaatgctg
agtgcaactcggcttctgacgttgcatggcaagtgcaggctgtcgtggactaccttgact
gtctcgagaccgacagcatcgaggaagcggttgatgcaactcagtttcggaaaatcgcgg
ccaacctgaagcgcgccacggcttttcggcaaccgaagaagattccgggtaaagcctcaa
agggacggcggttaacgcgcgcggggttactacagcgatatcagtcttttctaatcgagg
aacttttcactctgagctgcgagctctatggcgatccacaatatgcgctgcaatacgttt
tattcgatgacgcggtgcacaaggccctcaaaacagggacgcgcaaacgaactgacgttt
ttctggattccgttagcctgacttcacgcgctcgatcggtcttgaagtccctcaaaatcg
acactgagaatgtggggcgctgatcatgctgcagcttcctttttccagtcccagcaaagc
cattccgacgtcttcgccgcctcttaaggacaccacgttcgaccgcatccgtcgtcacaa
ggttcttggcgaacaggtcctggctctctcggaggcggaagatcagaccatcgcagcagc
gcagcagatttacggtaagcggcccctcgccctcatcgcgtggcattactattccgccat
cggtggcgatgagatcaagagggcgcgccgcgagttctttgaccagggcatgcctgcgga
tgtcgtcgagcgagagtatctggatgccaagcgtcgctaccgggaacggaaggctgagtg
cctgcgctggaacaaggcggcgggtgtctaccagatcgaccggcaaatcaaagccttcgt
caaggaacgttggaatatcatccagtcgttcattgatgagccgccgcgcaccgcgaaagc
agcgtcagcgctgatcttctacctcctggagttttacgatggg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01NH2906 Nitrobacter hamburgensis X14     conserved hypothetical protein
fig|323097.3.peg.3087 Nitrobacter hamburgensis X14 FIG   hypothetical protein
gb|ABE63201.1 Nitrobacter hamburgensis X14     hypothetical protein Nham_2410
gi|91800826 Nitrobacter hamburgensis X14 NCBI   hypothetical protein Nham_2410
gi|92117932 Nitrobacter hamburgensis X14 NCBI   hypothetical protein Nham_2410
img|637970870 Nitrobacter hamburgensis X14 IMG   hypothetical protein
kegg|nha:Nham_2410 Nitrobacter hamburgensis X14 KEGG   hypothetical protein
ref|YP_577661.1 Nitrobacter hamburgensis X14 RefSeq   hypothetical protein Nham_2410
tr|Q1QKP6 Nitrobacter hamburgensis (strain X14 / DSM 10229) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search