The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|320842.3.peg.30: Bacteriophage 96

This feature in The SEED Viewer

NCBI Taxonomy Id: 320842

Current Assignment: Phage phi 11 orf17 protein homolog
Translate Function Assignments



Context on contig NC_007057 from base 32052 to 42433 (10382 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
22 32052 32588 537 +           Phage phi 11 orf61 protein homolog YP_240274.1, gi|66395907
23 32589 33368 780 + 0         Phage phi 11 orf12 protein homolog YP_240275.1, gi|66395899
24 33398 33952 555 + 29     1: 1   Phage ssDNA binding protein YP_240276.1, gi|66395906
25 33965 34636 672 + 12         Phage phi 11 orf14 protein homolog YP_240277.1, gi|66395903
26 34629 35384 756 + -8     1: 1   Phage replication initiation protein YP_240278.1, gi|66395900
27 35384 35740 357 + -1         Phage phi 11 orf59 protein homolog YP_240279.1, gi|66395927
28 35737 36978 1242 + -4     1: 1   Phage DNA helicase (EC 3.6.4.12) YP_240280.1, gi|66395893
29 36975 37190 216 + -4         Phage protein YP_240281.1, gi|66395946
30 37194 37415 222 + 3         Phage phi 11 orf17 protein homolog YP_240282.1, gi|66395944
31 37426 37830 405 + 10         Phage phi 11 orf18 protein homolog YP_240283.1, gi|66395917
32 37835 38020 186 + 4         Phage phi 11 orf19 protein homolog YP_240284.1, gi|66395957
33 38021 38278 258 + 0         Phage transcriptional regulator cro YP_240285.1, gi|66395939
34 38290 38649 360 + 11         Phage phi 11 orf21 protein homolog YP_240286.1, gi|66395925
35 38649 38906 258 + -1         Phage protein YP_240287.1, gi|66395938
36 38909 39109 201 + 2         Phage protein YP_240288.1, gi|66395948
37 39124 39366 243 + 14         Phage phi 11 orf22 protein homolog YP_240289.1, gi|66395941
38 39381 39773 393 + 14         Phage phi 11 orf23 protein homolog YP_240290.1, gi|66395920
39 39770 39961 192 + -4         Phage protein YP_240291.1, gi|66395955
40 39961 40392 432 + -1         Hypothetical protein, SAB1734c homolog [SA bacteriophages 11, Mu50B] YP_240292.1, gi|66395915
41 40385 40636 252 + -8         Phage phi 11 orf23 protein homolog YP_240293.1, gi|66395942
42 40626 40799 174 + -11         Phage protein YP_240294.1, gi|66395954
43 40800 41081 282 + 0         Phage protein YP_240295.1, gi|66395936
44 41082 41243 162 + 0         Phage protein YP_240296.1, gi|66395961
45 41258 41791 534 + 14     1: 2   Phage dimeric dUTPase (EC 3.6.1.23) YP_240297.1, gi|66395908
46 41828 42016 189 + 36         Phage phi 11 orf26a protein homolog YP_240298.1, gi|66395956
48 41877 41978 102 + -140         Phage protein YP_240300.1, gi|66395964
49 41991 42200 210 + 12         Phage protein YP_240301.1, gi|66395947
47 42367 41861 507 - -340         Phage protein YP_240299.1, gi|66395909
50 42197 42433 237 + -171         Phage protein YP_240302.1, gi|66395940

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|320842.3.peg.30 Phage phi 11 orf17 protein homolog
MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLY
EQELGLQATIFDI

MD5 = 384e27a8d6eef118975e60982929395c


  DNA Sequence

>fig|320842.3.peg.30 Phage phi 11 orf17 protein homolog
atgccgaaagaaaaatattacttataccgagaagatggcacggaagatattaaggtcatc
aagtataaagacaacgtaaatgaagtttattcgctcacaggagcccatttcagcgacgaa
aagaaaattatgactgatagtgacctaaaacgatttaaaggcgctcacgggcttctatat
gagcaagagctaggattgcaagcaacgatatttgatatttag


  DNA with Flanking Sequence

>fig|320842.3.peg.30 Phage phi 11 orf17 protein homolog
aacgagacaggcgcaatcatcgtactactttcacaactgaatcgtggtgtcgagtctaga
caggataaaagaccaatgctatcggacatgaaagaatcaggcggaatagaagcagatgcg
agtttagcgatgctactttaccgtgatgattattataaccgtgacgaagatgacagtatc
actggcaaatctattgttgaatgtaacatagccaaaaacaaagacggcgaaaccggaata
attgaatttgagtattacaagaagactcagaggtttttcacatgaatataatgcaattca
aaagcttattgaaatcgatgtatgaagagacaaagcaaagcgacccgattgtagcaaatg
tatatatcgagactggttgggcggtcaatagattgttggacaataacgagttatcgcctt
tcgatgattacgacagagttgaaaagaaaatcatgaatgaaatcaactggaagaaaacac
acattaaggagtgttaaaaaatgccgaaagaaaaatattacttataccgagaagatggca
cggaagatattaaggtcatcaagtataaagacaacgtaaatgaagtttattcgctcacag
gagcccatttcagcgacgaaaagaaaattatgactgatagtgacctaaaacgatttaaag
gcgctcacgggcttctatatgagcaagagctaggattgcaagcaacgatatttgatattt
agaggtggcacaatgagtaaatacaatgctaagaaagttgagtacaaaggaattgtattt
gatagcaaagtagagtgcgaatattaccaatatttagaaagtaatatgaatggcactaac
tatgatcgtatcgaaatacaaccgaaatttgaattacaacctaaattcgggaaacaaaga
ccgattacgtatatagccgatttctctttgtggaaggaagggaaactggttgaagttata
gacgttaaaggtaaggcgactgaagttgccaacatcaaagcgaagatattcagatatcag
tatagagatgtgaatttaacgtggatatgtaaagcgcctaaatacacaggtcaagaatgg
atggtatatgaggacttagtgaaagtcagacgtaaaagaaaaagagaaatgaagtgatct
aatgcaacaacaagcatatataaacgcaacaattgatataagaatacctacagaagttga
atatcagcattacgatgatgtg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1868 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL0345 Staphylococcus aureus subsp. aureus COL     hypothetical protein
dbj|BAA97610.1 Staphylococcus phage phiETA     unnamed protein product
fig|106284.1.peg.24 Bacteriophage phi ETA FIG   Phage phi 11 orf17 protein homolog
fig|12360.1.peg.17 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf17 protein homolog
fig|259901.1.peg.46 Bacteriophage 77 FIG   Phage phi 11 orf17 protein homolog
fig|320834.3.peg.59 Bacteriophage 69 FIG   Phage phi 11 orf17 protein homolog
fig|320837.3.peg.59 Bacteriophage 42e FIG   Phage phi 11 orf17 protein homolog
fig|320846.3.peg.63 Bacteriophage 29 FIG   Phage phi 11 orf17 protein homolog
fig|320847.3.peg.36 Bacteriophage 52A FIG   Phage phi 11 orf17 protein homolog
fig|548470.3.peg.1894 Staphylococcus aureus subsp. aureus MN8 FIG   Phage phi 11 orf17 protein homolog
fig|553571.3.peg.2313 Staphylococcus aureus A6300 FIG   Phage phi 11 orf17 protein homolog
fig|585151.3.peg.1541 Staphylococcus aureus subsp. aureus C427 FIG   Phage phi 11 orf17 protein homolog
fig|585155.3.peg.2593 Staphylococcus aureus subsp. aureus H19 FIG   Phage phi 11 orf17 protein homolog
fig|668618.2.peg.24 Staphylococcus phage P954 FIG   Phage phi 11 orf17 protein homolog
fig|681288.4.peg.843 Staphylococcus aureus subsp. aureus ED98 FIG   Phage phi 11 orf17 protein homolog
fig|93061.3.peg.1950 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf17 protein homolog
fig|93061.5.peg.1873 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf17 protein homolog
fig|93062.4.peg.804 Staphylococcus aureus subsp. aureus COL FIG   Phage phi 11 orf17 protein homolog
gb|AAL82245.1 Staphylococcus aureus phage phi 11     phi ETA orf 24-like protein
gb|AAR87921.1 Bacteriophage 77     77ORF059
gb|AAW37552.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0345
gb|AAX90806.1 Bacteriophage 69     ORF064
gb|AAX91172.1 Bacteriophage 42e     ORF073
gb|AAX91476.1 Bacteriophage 96     ORF073
gb|AAX91773.1 Bacteriophage 29     ORF065
gb|AAX91844.1 Bacteriophage 52A     ORF068
gb|ABD31117.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gb|ACV04965.1 Staphylococcus phage P954     hypothetical protein
gb|EEI95864.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gb|EEV76884.1 Staphylococcus aureus A6300     conserved hypothetical protein
gi|17426252 Staphylococcus phage phiETA NCBI   hypothetical protein phiETA_24
gi|18920504 Staphylococcus aureus phage phi 11 NCBI   phi ETA orf 24-like protein
gi|227246105 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227557498 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|256681222 Staphylococcus phage P954 NCBI   hypothetical protein
gi|257136380 Staphylococcus phage P954 NCBI   hypothetical protein
gi|257853929 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258447270 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|29028580 Staphylococcus phage 11 NCBI   phi ETA orf 24-like protein
gi|40557265 Bacteriophage 77 NCBI   77ORF059
gi|41189564 Staphylococcus phage 77 NCBI   77ORF059
gi|57285458 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0345
gi|57651272 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0345
gi|62635695 Bacteriophage 69 NCBI   ORF064
gi|62636061 Bacteriophage 42e NCBI   ORF073
gi|62636365 Bacteriophage 96 NCBI   ORF073
gi|62636662 Bacteriophage 29 NCBI   ORF065
gi|62636733 Bacteriophage 52A NCBI   ORF068
gi|66395344 Staphylococcus phage 69 NCBI   ORF064
gi|66395568 Staphylococcus phage 42E NCBI   ORF073
gi|66395944 Staphylococcus phage 96 NCBI   ORF073
gi|66396245 Staphylococcus phage 29 NCBI   ORF065
gi|66396317 Staphylococcus phage 52A NCBI   ORF068
gi|87203307 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195749 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02065
gi|8918439 Staphylococcus phage phiETA NCBI   unnamed protein product
img|637151120 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637894692 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638290211 Bacteriophage phi ETA IMG   hypothetical protein
img|638297012 Staphylococcus phage 11 IMG   phi ETA orf 24-like protein
img|638305524 Bacteriophage 77 IMG   77ORF059
img|638314042 Bacteriophage 69 IMG   ORF064
img|638314331 Bacteriophage 42e IMG   ORF073
img|638314701 Bacteriophage 96 IMG   ORF073
img|638315010 Bacteriophage 29 IMG   ORF065
img|638315076 Bacteriophage 52A IMG   ORF068
kegg|sac:SACOL0345 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sao:SAOUHSC_02065 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|NP_510918.1 Staphylococcus phage phiETA RefSeq   hypothetical protein phiETA_24
ref|NP_803270.1 Staphylococcus phage 11 RefSeq   phi ETA orf 24-like protein
ref|NP_958647.1 Staphylococcus phage 77 RefSeq   77ORF059
ref|YP_003169654.1 Staphylococcus phage P954 RefSeq   hypothetical protein
ref|YP_185237.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0345
ref|YP_239623.1 Staphylococcus phage 69 RefSeq   ORF064
ref|YP_239912.1 Staphylococcus phage 42E RefSeq   ORF073
ref|YP_240282.1 Staphylococcus phage 96 RefSeq   ORF073
ref|YP_240591.1 Staphylococcus phage 29 RefSeq   ORF065
ref|YP_240657.1 Staphylococcus phage 52A RefSeq   ORF068
ref|YP_500558.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02065
ref|ZP_03987545.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_05695418.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
tr|C2K605 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|Q2FX35 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZAR9 Staphylococcus phage 52A TrEMBL   ORF068
tr|Q4ZAY5 Staphylococcus phage 29 TrEMBL   ORF065
tr|Q4ZBU4 Staphylococcus phage 96 TrEMBL   ORF073
tr|Q4ZCW4 Staphylococcus phage 42E TrEMBL   ORF073
tr|Q4ZDQ3 Staphylococcus phage 69 TrEMBL   ORF064
tr|Q5HJ20 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6R836 Staphylococcus phage 77 TrEMBL   77ORF059
tr|Q776M5 Staphylococcus phage phiETA TrEMBL   ORF24
tr|Q9G021 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Phi ETA orf 24-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search