The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|319701.3.peg.1655: Streptococcus pyogenes MGAS6180

This feature in The SEED Viewer

NCBI Taxonomy Id: 319701

Current Assignment: DNA replication protein DnaD
Translate Function Assignments



Context on contig NC_007296 from base 1257534 to 1269128 (11595 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1640 1258040 1257534 507 -         ff conserved hypothetical protein - phage associated LocusTag:M28_Spy1259, GeneID:3573967, YP_280724.1, gi|71903921
1641 1258207 1258037 171 - -4       ff hypothetical protein (phage associated) LocusTag:M28_Spy1260, GeneID:3573968, YP_280725.1, gi|71903922
1642 1258608 1258204 405 - -4       ff hypothetical protein (phage associated) LocusTag:M28_Spy1261, GeneID:3573969, YP_280726.1, gi|71903923
1643 1258917 1258618 300 - 9       ff conserved hypothetical protein - phage associated LocusTag:M28_Spy1262, GeneID:3573970, YP_280727.1, gi|71903924
1644 1259168 1258884 285 - -34       ff hypothetical protein (phage associated) LocusTag:M28_Spy1263, GeneID:3573971, YP_280728.1, gi|71903925
1645 1259413 1259162 252 - -7       ff hypothetical protein LocusTag:M28_Spy1264, GeneID:3573972, YP_280729.1, gi|71903926
1646 1259766 1259410 357 - -4       ff FIG01114622: hypothetical protein LocusTag:M28_Spy1265, GeneID:3573973, YP_280730.1, gi|71903927
1647 1260203 1259763 441 - -4     2: 2 5 ff Phage Holliday junction resolvase LocusTag:M28_Spy1266, GeneID:3573974, YP_280731.1, gi|71903928
1648 1260406 1260203 204 - -1     1: 1 ff Phage protein LocusTag:M28_Spy1267, GeneID:3573975, YP_280732.1, gi|71903929
1649 1260831 1260412 420 - 5     4: 1 3 6 4 ff
idu(2)
idu(2)
ilit(
8063092)
Single-stranded DNA-binding protein # phage-related GENE:ssb2.1, LocusTag:M28_Spy1268, GeneID:3573976, ssb2.1, YP_280733.1, gi|71903930
1650 1261498 1260824 675 - -8       ff Phage single-strand DNA binding protein GENE:ssb1, LocusTag:M28_Spy1269, GeneID:3573977, ssb1, YP_280734.1, gi|71903931
1651 1261981 1261499 483 - 0       ff Phage protein LocusTag:M28_Spy1270, GeneID:3573978, YP_280735.1, gi|71903932
1652 1262278 1262003 276 - 21       ff hypothetical protein - phage associated LocusTag:M28_Spy1271, GeneID:3573979, YP_280736.1, gi|71903933
1653 1262408 1262268 141 - -11       ff hypothetical protein LocusTag:M28_Spy1272, GeneID:3573980, YP_280737.1, gi|71903934
1654 1262638 1262405 234 - -4       ff hypothetical protein LocusTag:M28_Spy1273, GeneID:3573981, YP_280738.1, gi|71903935
1655 1263032 1262619 414 - -20       ff DNA replication protein DnaD LocusTag:M28_Spy1274, GeneID:3573982, YP_280739.1, gi|71903936
1656 1263411 1263154 258 - 121       ff Phage replication protein LocusTag:M28_Spy1275, GeneID:3573983, YP_280740.1, gi|71903937
1657 1263690 1263505 186 - 93       ff Phage protein LocusTag:M28_Spy1276, GeneID:3573984, YP_280741.1, gi|71903938
1658 1264063 1263719 345 - 28       ff hypothetical protein LocusTag:M28_Spy1277, GeneID:3573985, YP_280742.1, gi|71903939
1659 1264476 1264222 255 - 158       ff hypothetical protein - phage associated LocusTag:M28_Spy1278, GeneID:3573986, YP_280743.1, gi|71903940
1660 1264811 1264662 150 - 185       ff hypothetical protein - phage associated LocusTag:M28_Spy1279, GeneID:3573987, YP_280744.1, gi|71903941
1661 1265572 1264844 729 - 32     1: 1 ff Phage antirepressor protein LocusTag:M28_Spy1280, GeneID:3573988, YP_280745.1, gi|71903942
1662 1265774 1265583 192 - 10       ff conserved hypothetical protein - phage associated LocusTag:M28_Spy1281, GeneID:3573989, YP_280746.1, gi|71903943
1663 1266570 1266929 360 + 795       cwh
ff
Phage transcriptional regulator LocusTag:M28_Spy1282, GeneID:3573990, YP_280747.1, gi|71903944
1664 1266943 1267323 381 + 13       cwn
ff
Phage protein LocusTag:M28_Spy1283, GeneID:3573991, YP_280748.1, gi|71903945
1665 1267334 1267855 522 + 10       ff Hypothetical protein-phage associated LocusTag:M28_Spy1284, GeneID:3573992, YP_280749.1, gi|71903946
1666 1267971 1269128 1158 + 115     2: 2 7 ff Phage integrase LocusTag:M28_Spy1285, GeneID:3573993, YP_280750.1, gi|71903947

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|319701.3.peg.1655 DNA replication protein DnaD
MMKKKGEALDKKELFDNFQNNWMRLLSPFEIEDINKWIDEEKMPVEVVNEALKSTILYNA
PNLRYLNRVLNNWKRQGIDTVEKVEFARLQFENKKLSQNKNHQSNVPSWSNPDYKEPDLK
EFALGSIDGIEDGSGDF

MD5 = 33764806d6feb54391a06a54a35a2248


  DNA Sequence

>fig|319701.3.peg.1655 DNA replication protein DnaD
atgatgaagaagaaaggagaagcattggacaaaaaagaactgtttgataatttccaaaat
aattggatgcgtctcttatcaccatttgagattgaagacattaataagtggattgacgaa
gagaagatgcctgttgaagttgttaacgaggcactaaaatcgacaattctatacaacgca
ccaaaccttagatacttaaacagagtcttgaacaactggaagcgacaagggattgataca
gtcgagaaagtcgaatttgctaggttgcaatttgaaaataaaaagctcagtcaaaataaa
aatcatcaatccaacgtcccaagctggtcgaatccagactacaaagaaccagatttaaaa
gaatttgcactaggaagcatagacggtatagaagatggatcaggagatttttaa


  DNA with Flanking Sequence

>fig|319701.3.peg.1655 DNA replication protein DnaD
gcgctctagaggagaggtggtcagctgatgcagtacatttttcaagacgctacgaggtaa
ttttactagtgttagtaatgagtttattgatgataaagaactatcttataaatccgttgg
attgctattgaccatcctaagaaataaagatgagtggcgagtatacccagaagagcttgc
tagaagacattctgatggtttagcttctgtaagagcaggccttagagagcttgagaaggc
aggatatgttagaacttacaaaaagataactaggcgttctgagggactgcaacattaccg
tttctgttcggattgtaagattagtgatgaagtttttcagcgattagttgagcaattaga
aaatgaactctccgactaaaatgcgattttctaaagttagaaaatctaaagttagaaaat
ctaaagttagaatttcgcacactaataaatactaacattaaataaatactaaataacaat
aaatactaacagacaataagatgatgaagaagaaaggagaagcattggacaaaaaagaac
tgtttgataatttccaaaataattggatgcgtctcttatcaccatttgagattgaagaca
ttaataagtggattgacgaagagaagatgcctgttgaagttgttaacgaggcactaaaat
cgacaattctatacaacgcaccaaaccttagatacttaaacagagtcttgaacaactgga
agcgacaagggattgatacagtcgagaaagtcgaatttgctaggttgcaatttgaaaata
aaaagctcagtcaaaataaaaatcatcaatccaacgtcccaagctggtcgaatccagact
acaaagaaccagatttaaaagaatttgcactaggaagcatagacggtatagaagatggat
caggagatttttaatttttttaacaaacaaatcaaaaaagattttggtaaaacggcgagt
aaagagacttttgctaagtttgctagttactgcgccgaaggaatcgaaaaaaaaggagtt
aagccaatttttaattggataaacctatacgcattcggccttggaataacaacggcagaa
gcagaccgattgagaatagagcgatataaacaggagaatgcgttatgacaaaacaacata
gagagacgcttatctggtaccgagcaagccatcaagagcgtgagagattgcttgatttcg
ggttagttgataaatcacagtacgtgacactattgcggcaattgcgcaagaaatatgcga
tttaggaagggatatatggttgaaatcagaattaacggtgagctcgtaacctttgacagc
aattttagagatgcgcttatctttacgattgactgtcttagaggtagcgaagaacctacg
ctaaaacagacttatcaaacctttaaagactaca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT04SP1407 Streptococcus pyogenes MGAS315     DnaD-like domain family
cmr|NT06SP0641 Streptococcus pyogenes SSI-1     DnaD-like domain protein
cmr|NT13SP1320 Streptococcus pyogenes MGAS6180     ORF1
dbj|BAC63704.1 Streptococcus pyogenes SSI-1     conserved hypothetical protein (phage associated)
fig|173707.1.peg.8 Temperate phage PhiNIH1.1 FIG   DNA replication protein DnaD
fig|193567.1.peg.609 Streptococcus pyogenes SSI-1 FIG   DNA replication protein DnaD
fig|198466.1.peg.1254 Streptococcus pyogenes MGAS315 FIG   DNA replication protein DnaD
fig|198541.1.peg.13 Streptococcus pyogenes phage 315.4 FIG   DNA replication protein DnaD
fig|370552.3.peg.1350 Streptococcus pyogenes MGAS10270 FIG   DNA replication protein DnaD
gb|AAL15050.1 temperate phage PhiNIH1.1     hypothetical protein-phage associated
gb|AAM79861.1 Streptococcus pyogenes MGAS315     conserved hypothetical protein - phage-associated
gb|AAX72384.1 Streptococcus pyogenes MGAS6180     DnaD-like protein
gb|ABF34415.1 Streptococcus pyogenes MGAS10270     DNA replication protein dnaD
gi|16156176 temperate phage PhiNIH1.1 NCBI   hypothetical protein-phage associated
gi|16271784 Temperate phage phiNIH1.1 NCBI   hypothetical protein phiNIH1.1_08
gi|21904994 Streptococcus pyogenes MGAS315 NCBI   conserved hypothetical protein - phage-associated
gi|21910790 Streptococcus pyogenes MGAS315 NCBI   hypothetical protein SpyM3_1254
gi|28810770 Streptococcus pyogenes SSI-1 NCBI   conserved hypothetical protein (phage associated)
gi|28876368 Streptococcus pyogenes phage 315.4 NCBI   hypothetical protein SpyM3_1254
gi|28895521 Streptococcus pyogenes SSI-1 NCBI   hypothetical protein SPs0609
gi|71803031 Streptococcus pyogenes MGAS6180 NCBI   DnaD-like protein
gi|71903936 Streptococcus pyogenes MGAS6180 NCBI   DnaD-like protein
gi|94544367 Streptococcus pyogenes MGAS10270 NCBI   DNA replication protein dnaD
gi|94990859 Streptococcus pyogenes MGAS10270 NCBI   DNA replication protein dnaD
img|637307783 Streptococcus pyogenes MGAS315 IMG   hypothetical protein
img|637402582 Streptococcus pyogenes SSI-1 IMG   conserved hypothetical protein (phage associated)
img|637675829 Streptococcus pyogenes MGAS6180 IMG   DnaD-like protein
img|637992062 Streptococcus pyogenes MGAS10270 IMG   DNA replication protein dnaD
img|638289349 Temperate phage phiNIH1.1 IMG   hypothetical protein
img|638296801 Streptococcus pyogenes phage 315.4 IMG   hypothetical protein
kegg|spb:M28_Spy1274 Streptococcus pyogenes MGAS6180 (serotype M28) KEGG   DnaD-like protein
kegg|spg:SpyM3_1254 Streptococcus pyogenes MGAS315 (serotype M3) KEGG   hypothetical protein
kegg|sph:MGAS10270_Spy1350 Streptococcus pyogenes MGAS10270 (serotype M2) KEGG   DNA replication protein DnaD
kegg|sps:SPs0609 Streptococcus pyogenes SSI-1 (serotype M3) KEGG   hypothetical protein
ref|NP_438121.1 Temperate phage phiNIH1.1 RefSeq   hypothetical protein phiNIH1.1_08
ref|NP_665058.1 Streptococcus pyogenes MGAS315 RefSeq   hypothetical protein SpyM3_1254
ref|NP_795553.1 Streptococcus pyogenes phage 315.4 RefSeq   hypothetical protein SpyM3_1254
ref|NP_801871.1 Streptococcus pyogenes SSI-1 RefSeq   hypothetical protein SPs0609
ref|YP_280739.1 Streptococcus pyogenes MGAS6180 RefSeq   DnaD-like protein
ref|YP_598959.1 Streptococcus pyogenes MGAS10270 RefSeq   DNA replication protein dnaD
tr|Q1CQ13 Streptococcus pyogenes serotype M2 (strain MGAS10270) TrEMBL   DNA replication protein dnaD
tr|Q48SC6 Streptococcus pyogenes serotype M28 TrEMBL   DnaD-like protein
tr|Q79XW3 Streptococcus pyogenes serotype M3 TrEMBL   Putative uncharacterized protein
tr|Q938N2 Temperate phage phiNIH1.1 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33717 978.700;3-131
CDD::44184 980.200;14-86
CELLO::cytoplasm 2.518
evidence_code ff
IPR::IPR006343 964.400;14-86
isoelectric_point 4.87
molecular_weight 16095
PFAM::PF04271 964.150;14-86
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search