The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|286604.5.peg.1710: Streptococcus suis 89/1591

This feature in The SEED Viewer

NCBI Taxonomy Id: 286604

Current Assignment: Antirepressor
Translate Function Assignments



Context on contig NZ_AAFA03000052 from base 1874 to 10702 (8829 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1709 2098 1874 225 -           hypothetical protein locus|SsuiDRAFT_2243, protein_id|ZP_03625985.1, gi|223934032
1710 3928 3218 711 - 1119       Antirepressor locus|SsuiDRAFT_2247, protein_id|ZP_03625989.1, gi|223934036, InterPro:IPR005039, InterPro:IPR013557
1711 4003 4206 204 + 74         hypothetical protein locus|SsuiDRAFT_2248, protein_id|ZP_03625990.1, gi|223934037
1712 4484 4362 123 - 155         hypothetical protein locus|SsuiDRAFT_2250, protein_id|ZP_03625992.1, gi|223934039
1713 4804 4619 186 - 134         ORF049 locus|SsuiDRAFT_2251, protein_id|ZP_03625993.1, gi|223934040, InterPro:IPR001387
1714 4882 5601 720 + 77         hypothetical protein locus|SsuiDRAFT_2252, protein_id|ZP_03625994.1, gi|223934041
1715 5936 6691 756 + 334 4     Phage transcriptional repressor locus|SsuiDRAFT_2254, protein_id|ZP_03625996.1, gi|223934043, InterPro:IPR001387, InterPro:IPR011056
1716 6867 7301 435 + 175         hypothetical protein locus|SsuiDRAFT_2255, protein_id|ZP_03625997.1, gi|223934044
1717 7427 8521 1095 + 125         prophage LambdaSa2, site-specific recombinase, phage integrase family locus|SsuiDRAFT_2256, protein_id|ZP_03625998.1, gi|223934045, InterPro:IPR002104
rna.44 8630 8559 72 - 37         tRNA-Arg-CCT  
1718 10702 8828 1875 - 197     3: 1 2 3   5'-nucleotidase (EC 3.1.3.5) locus|SsuiDRAFT_2257, protein_id|ZP_03625999.1, gi|223934046, InterPro:IPR001899, InterPro:IPR004843, InterPro:IPR006179, InterPro:IPR008334

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|286604.5.peg.1710 Antirepressor
MNEIINVNVNDNQEPVVSGRQLHGALGVKTAYKDWFPRMTEYGFVEGQDFCSNLSESTGG
RRAVDHIIKLDMAKEIAMIQRTDRGKQVRQYFIQVEKDFNSPEKIMARALLLADKKVHQL
EAQIEADKPKVLFADAVSASHSSILVGDLAKLISQNGFKIGANRLFAWLRENGYLIKRKG
SDWNMPTQKSMELGLFEIKETTITHADGHISISKTVKVTGKGQQYFINKFLADDVA

MD5 = b0b9df81af72f1068dc9ffb4cb4dc4de


  DNA Sequence

>fig|286604.5.peg.1710 Antirepressor
atgaacgaaattataaacgttaatgtgaacgacaatcaagagcctgttgtgtctggtcgg
cagttgcatggggctttgggtgtcaagacggcatataaggactggttccctagaatgacc
gaatatggatttgtcgaaggacaggacttctgctcaaatttgagcgaaagtacgggaggt
cgtcgagcggttgaccacattatcaagctggacatggccaaggaaattgctatgatccaa
cggacagaccgtggcaagcaggttcgtcagtactttatccaggttgaaaaggactttaac
agtccagagaagattatggcacgggctctgctattggctgacaagaaggtgcatcagctg
gaagcacagattgaggcggacaagcccaaggtgctgtttgcagacgctgtgagtgccagt
cactcatctatcttggttggagacctagctaagttaatcagtcaaaacggctttaaaatc
ggcgcaaatcgcttgtttgcgtggttgcgtgagaatggctatctgattaagcgcaagggc
agcgattggaatatgccgacgcagaagtctatggaactaggtttatttgaaatcaaagag
acgactatcacacatgctgacggtcatatctcgattagcaaaactgtaaaagttactggc
aaaggtcagcagtattttatcaataaatttttggctgatgatgttgcttga


  DNA with Flanking Sequence

>fig|286604.5.peg.1710 Antirepressor
aggcttgaaacgtgctcgtattgaagaagtcatcatcaagactaagcgtctagttcttga
ggactagaaaggagaaggggatgagaccaaaacggtatccgtatagcggaaaattaaaag
cctcaactatggatatagtcaaggcttgggaaaaagcttattcagcatatcgtgtcaaag
gtcaaaaaaggcaagaaaaggctgaacaagaattagacaaagctactcagaggctttatc
agctatatcattgagtgtcttcgctgctttctcggtagcaagtcgatcaacttgcatatc
tttggcagctaacaacttttcaatgacatcaataatagcggtagttgcaacatcagctgg
atttttctcaatgtactcagcaattagtttgtaactagcttgtttaagactttcaaagtc
attcatacactaatcctcctttccttgttgatataccaattatatcacggggaggagcaa
ccaaactagaaaggaattttatgaacgaaattataaacgttaatgtgaacgacaatcaag
agcctgttgtgtctggtcggcagttgcatggggctttgggtgtcaagacggcatataagg
actggttccctagaatgaccgaatatggatttgtcgaaggacaggacttctgctcaaatt
tgagcgaaagtacgggaggtcgtcgagcggttgaccacattatcaagctggacatggcca
aggaaattgctatgatccaacggacagaccgtggcaagcaggttcgtcagtactttatcc
aggttgaaaaggactttaacagtccagagaagattatggcacgggctctgctattggctg
acaagaaggtgcatcagctggaagcacagattgaggcggacaagcccaaggtgctgtttg
cagacgctgtgagtgccagtcactcatctatcttggttggagacctagctaagttaatca
gtcaaaacggctttaaaatcggcgcaaatcgcttgtttgcgtggttgcgtgagaatggct
atctgattaagcgcaagggcagcgattggaatatgccgacgcagaagtctatggaactag
gtttatttgaaatcaaagagacgactatcacacatgctgacggtcatatctcgattagca
aaactgtaaaagttactggcaaaggtcagcagtattttatcaataaatttttggctgatg
atgttgcttgagaaacaaaaaaagcctgacggcaatcaggctcaatgaaaaactatataa
aggtattatatcacaatgaatacagaaacaataacaataaacaaaaatgaactagaggag
ttgattgctaaagaggtggctaaaaaaattacctcacaagcaaataattctgtttttaaa
gacctagctattattgataaaagagttgcagaaataaatagagaatacccagagattgtt
cagtatgtacaggaacagtcgaaaagaccgcctgcttatcacatatctcttacagaactt
gtacatgagagaagccgttggggagatggttttatgttcactaaaccgtcgttatatgct
gatccagaaacgctcatcagaaaacttgtttgcttaatgtttggagcaaaaaatgttagg
gagttggatggtagagatgtcgaaatagctagaagtatgtattatgaaatttcaaatata
tttattaatacatacaagggacacctagaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|EEF63701.1 Streptococcus suis 89/1591     phage antirepressor protein
gi|223897293 Streptococcus suis 89/1591 NCBI   phage antirepressor protein
gi|223934036 Streptococcus suis 89/1591 NCBI   phage antirepressor protein
img|638467000 Streptococcus suis 89/1591 IMG   Phage antirepressor protein
ref|ZP_03625989.1 Streptococcus suis 89/1591 RefSeq   phage antirepressor protein
tr|B9WXR8 Streptococcus suis 89/1591 TrEMBL   Phage antirepressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|286604.5.peg.1715 Phage transcriptional repressor


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search