The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1301: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: Phage minor capsid protein
Translate Function Assignments



Context on contig NC_003212 from base 1267399 to 1281098 (13700 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1294 1267399 1268736 1338 +       1: 1   Phage DNA modification methylase locus|lin1262, protein_id|NP_470599.1, gi|16800331, geneID|1129832
1295 1268784 1268981 198 + 47         hypothetical protein locus|lin1263, protein_id|NP_470600.1, gi|16800332, geneID|1129833
1296 1269111 1269341 231 + 129         FIG00774828: hypothetical protein locus|lin1264, protein_id|NP_470601.1, gi|16800333, geneID|1129834
1297 1269369 1269593 225 + 27         hypothetical protein locus|lin1265, protein_id|NP_470602.1, gi|16800334, geneID|1129835
1298 1269646 1270482 837 + 52         Phage terminase, small subunit locus|lin1266, protein_id|NP_470603.1, gi|16800335, geneID|1129836
1299 1270469 1271803 1335 + -14         Phage terminase, large subunit ## PBSX family locus|lin1267, protein_id|NP_470604.1, gi|16800336, geneID|1129838
1300 1271793 1273367 1575 + -11         Phage-like element PBSX protein XkdE locus|lin1268, protein_id|NP_470605.1, gi|16800337, geneID|1129840
1301 1273354 1275102 1749 + -14         Phage minor capsid protein locus|lin1269, protein_id|NP_470606.1, gi|16800338, geneID|1129842
1302 1275104 1275385 282 + 1         hypothetical protein  
1303 1275480 1276574 1095 + 94         Phage-like element PBSX protein XkdF locus|lin1270, protein_id|NP_470607.1, gi|16800339, geneID|1129843
1304 1276590 1277519 930 + 15         Phage-like element PBSX protein XkdG locus|lin1271, protein_id|NP_470608.1, gi|16800340, geneID|1129844
1305 1277525 1277737 213 + 5         hypothetical protein locus|lin1272, protein_id|NP_470609.1, gi|16800341, geneID|1129846
1306 1277749 1278153 405 + 11         Uncharacterized protein YqbG locus|lin1273, protein_id|NP_470610.1, gi|16800342, geneID|1129847
1307 1278155 1278514 360 + 1         Phage-like element PBSX protein XkdH locus|lin1274, protein_id|NP_470611.1, gi|16800343, geneID|1129849
1308 1278514 1279020 507 + -1         Phage-like element PBSX protein XkdI locus|lin1275, protein_id|NP_470612.1, gi|16800344, geneID|1129851
1309 1279502 1279738 237 + 481         hypothetical protein locus|lin1277, protein_id|NP_470614.1, gi|16800346, geneID|1129854
1310 1279740 1281098 1359 + 1         Phage-like element PBSX tail sheath protein XkdK locus|lin1278, protein_id|NP_470615.1, gi|16800347, geneID|1129856

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1301 Phage minor capsid protein
MVNYDAIDNLIDTINILVEKVNEGEFEKELLGQLGMKNIPAFVETFEKDISSLLLIQRSY
YINQLKKTVIKAEKPLTIEELFQYYSNDLFIGDDFRINMSKKASDFLTATTKDISKTVMK
SLDKDVSFKRLSGRSVSWIKEWSEDLANLMKISTQSEVEGVLIKALSEGKGIQHVELALK
DLPAFDRKRARTTAITEVLTAASVAQQEAFEQSPSVEGKKWKHSGGKGIEPRSSHIELSG
KVVQINETFTIPGSGELAKYPRDTDLSASERIHCHCALGPAVNEEILGWTKEDKEKARKE
VMDDLDKNPYTKKQKDAKKLANKVGQKIKNEQDILDAGEVVYKNIESKVNFYTRRIERLK
KINDKANRDLIFDKITAKEQIRTRFLTSNLQEKAAEKRLELIFSELKKIRKFGNVKMLNI
LDNSDLYLKQILINNKKYFPASWITESNKNSVLLLNLTKERGSQQLYKGVSIVSAGVHGT
KSTIIHEMMHHFEISVPGFLAAEKLFYERRTKGYDLVQLGYPYDDQEIARLDKFVIGYIG
KDYAGTGYEIMSVGLQEMMEADTRIFSDTDYIHFIIGMLARL

MD5 = 3fc5c124420292b13d9200058705cbfb


  DNA Sequence

>fig|272626.9.peg.1301 Phage minor capsid protein
atggtaaactatgacgctatagataaccttatcgatactatcaatatattagtagagaag
gttaatgaaggagaattcgaaaaagaactacttggacaactaggaatgaaaaatattccc
gcatttgttgagacgttcgagaaggacatttctagccttcttctaatccagaggtcttat
tatattaatcaacttaaaaaaactgtaataaaggcagaaaaaccacttacgattgaagaa
ttatttcaatactactctaatgatttgtttataggtgatgattttagaataaatatgtct
aaaaaagcatctgattttcttacagcaacaacaaaagacattagtaaaactgttatgaag
tcactagataaagatgtctctttcaaacgtttatctggacgttctgtgagctggattaaa
gaatggtcagaggatttggccaacctaatgaaaattagtactcaatccgaagtagagggg
gtgctaataaaggcactgagtgaagggaaaggtattcaacatgtagagctagcgctaaag
gatttacccgcatttgaccgaaaaagggcaaggacaacggctattacagaagttttgaca
gcagctagtgttgctcagcaagaagcttttgaacaatcaccatcagttgaaggcaagaaa
tggaagcattccggcggtaaaggaatcgaaccccgctcatcccatattgaattaagtgga
aaagtggtccagataaatgaaacgtttacgatacctggaagcggcgagttagcaaaatat
ccgagagatacagacttgtctgcttctgaaaggatacattgtcattgtgcccttggacca
gctgtaaatgaagagattctcggatggacaaaagaagataaagaaaaagcaagaaaagaa
gttatggacgatttagacaagaatccgtacactaaaaaacaaaaagatgcaaaaaaattg
gcgaataaagttggccaaaaaataaagaacgaacaggatattttagatgctggggaagta
gtgtataaaaacattgaatctaaagttaatttttatacaaggagaatagagcgtcttaaa
aagattaatgataaggctaatagagatttgatttttgataagataactgcaaaagagcaa
attagaacgaggttcttaacaagcaatctacaagaaaaagcagcagaaaaaagattagaa
cttattttttcggaactgaaaaagatacgaaaattcggcaatgttaagatgcttaatata
ttagataactcagatttataccttaaacagattttgataaataataagaaatactttcca
gcatcgtggattactgagtcgaacaagaacagtgttttacttttaaatttaacaaaagag
cgtggatcacaacaactatacaaaggagtcagcatagttagcgctggtgtccatggtaca
aaatcaacaataatccatgaaatgatgcatcactttgaaatttcagtaccgggatttctt
gctgctgaaaaacttttttatgagcgtagaacgaaaggatacgatttggtacaattaggt
tatccatacgatgatcaagaaatagctagattggataaattcgttattgggtacattgga
aaagattatgcaggaaccggttatgaaataatgagtgtaggattacaagagatgatggaa
gcagacactcgtatttttagtgatacagattatattcactttatcataggaatgttagcg
aggttatag


  DNA with Flanking Sequence

>fig|272626.9.peg.1301 Phage minor capsid protein
acacaggaaaaaaatgcgttcttctttccgattgccgccaatttatacaggtgaagcgga
cgaatataataaggccactgcagaaacagcacggaagacgacggaagaacaagtattcca
accgatgcgtagaaagttggccaggaagataaatggtgcttttttagaggcgttagatat
atctgaagccaaattagtattaaaaagtcctgatcttacagatattgcttcaatatccaa
tgctatatatccatttatctcagcagcatccgtcattcctaatgatttgcgtccaatgct
tgaaaaattattgaataggaagctagatgaattacctgaggaatacaacaaaccaatatc
tattcttctcgcagaaatgcaaggacaatctaatgaacatactgtttcggaaccgaagac
agttcaaaaatcactatctgaatacgataacgtattagtaatgaaacagatgagagattt
gttacaggagttgaaggacaatggtaaactatgacgctatagataaccttatcgatacta
tcaatatattagtagagaaggttaatgaaggagaattcgaaaaagaactacttggacaac
taggaatgaaaaatattcccgcatttgttgagacgttcgagaaggacatttctagccttc
ttctaatccagaggtcttattatattaatcaacttaaaaaaactgtaataaaggcagaaa
aaccacttacgattgaagaattatttcaatactactctaatgatttgtttataggtgatg
attttagaataaatatgtctaaaaaagcatctgattttcttacagcaacaacaaaagaca
ttagtaaaactgttatgaagtcactagataaagatgtctctttcaaacgtttatctggac
gttctgtgagctggattaaagaatggtcagaggatttggccaacctaatgaaaattagta
ctcaatccgaagtagagggggtgctaataaaggcactgagtgaagggaaaggtattcaac
atgtagagctagcgctaaaggatttacccgcatttgaccgaaaaagggcaaggacaacgg
ctattacagaagttttgacagcagctagtgttgctcagcaagaagcttttgaacaatcac
catcagttgaaggcaagaaatggaagcattccggcggtaaaggaatcgaaccccgctcat
cccatattgaattaagtggaaaagtggtccagataaatgaaacgtttacgatacctggaa
gcggcgagttagcaaaatatccgagagatacagacttgtctgcttctgaaaggatacatt
gtcattgtgcccttggaccagctgtaaatgaagagattctcggatggacaaaagaagata
aagaaaaagcaagaaaagaagttatggacgatttagacaagaatccgtacactaaaaaac
aaaaagatgcaaaaaaattggcgaataaagttggccaaaaaataaagaacgaacaggata
ttttagatgctggggaagtagtgtataaaaacattgaatctaaagttaatttttatacaa
ggagaatagagcgtcttaaaaagattaatgataaggctaatagagatttgatttttgata
agataactgcaaaagagcaaattagaacgaggttcttaacaagcaatctacaagaaaaag
cagcagaaaaaagattagaacttattttttcggaactgaaaaagatacgaaaattcggca
atgttaagatgcttaatatattagataactcagatttataccttaaacagattttgataa
ataataagaaatactttccagcatcgtggattactgagtcgaacaagaacagtgttttac
ttttaaatttaacaaaagagcgtggatcacaacaactatacaaaggagtcagcatagtta
gcgctggtgtccatggtacaaaatcaacaataatccatgaaatgatgcatcactttgaaa
tttcagtaccgggatttcttgctgctgaaaaacttttttatgagcgtagaacgaaaggat
acgatttggtacaattaggttatccatacgatgatcaagaaatagctagattggataaat
tcgttattgggtacattggaaaagattatgcaggaaccggttatgaaataatgagtgtag
gattacaagagatgatggaagcagacactcgtatttttagtgatacagattatattcact
ttatcataggaatgttagcgaggttatagaatgaagaactacttttatattaaaggaaaa
tttgcaggtgagattgtaatagtagaatttaaagatggtcagcttgaatccgacactaac
gagatggttaatttgattaaatcggcgtacaaacatggtaattatatcccgccaaatctt
tatataccagagaatggtctagaaaacgctgcttttgcttatcagtttttattagatcgg
atatttggtgaaattatagagacttcatacgatgctcctcttattccaaagttagaaaaa
ggagaaaaataaatgtaaaagacttagattattaattctaagtcttttttattgggttaa
aaagttcccataaaaaaactttaattatttgaaggaggtgaaaaatatggggagagaatt
agttaatgcaaagataaattatgtttcatatgttgataaagcggcaaataaaaaacagtt
tttcttaacaaaatcaaatgaacaacctaatatacagaagcaggttgag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01LI1322 Listeria innocua CLIP 11262     conserved hypothetical protein
emb|CAC96500.1 Listeria innocua EMBL   lin1269
fig|272626.1.peg.1259 Listeria innocua Clip11262 FIG   Phage minor capsid protein
gi|16413743 Listeria innocua NCBI   lin1269
gi|16800338 Listeria innocua Clip11262 NCBI   hypothetical protein lin1269
img|637223997 Listeria innocua Clip11262 IMG   hypothetical protein
kegg|lin:lin1269 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_470606.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1269
tr|Q92CC0 Listeria innocua TrEMBL   Lin1269 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search