The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1300: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: Phage-like element PBSX protein XkdE
Translate Function Assignments



Context on contig NC_003212 from base 1266855 to 1278514 (11660 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1293 1266855 1267334 480 +           hypothetical protein locus|lin1261, protein_id|NP_470598.1, gi|16800330, geneID|1129831
1294 1267399 1268736 1338 + 64     1: 1   Phage DNA modification methylase locus|lin1262, protein_id|NP_470599.1, gi|16800331, geneID|1129832
1295 1268784 1268981 198 + 47         hypothetical protein locus|lin1263, protein_id|NP_470600.1, gi|16800332, geneID|1129833
1296 1269111 1269341 231 + 129         FIG00774828: hypothetical protein locus|lin1264, protein_id|NP_470601.1, gi|16800333, geneID|1129834
1297 1269369 1269593 225 + 27         hypothetical protein locus|lin1265, protein_id|NP_470602.1, gi|16800334, geneID|1129835
1298 1269646 1270482 837 + 52         Phage terminase, small subunit locus|lin1266, protein_id|NP_470603.1, gi|16800335, geneID|1129836
1299 1270469 1271803 1335 + -14         Phage terminase, large subunit ## PBSX family locus|lin1267, protein_id|NP_470604.1, gi|16800336, geneID|1129838
1300 1271793 1273367 1575 + -11       Phage-like element PBSX protein XkdE locus|lin1268, protein_id|NP_470605.1, gi|16800337, geneID|1129840
1301 1273354 1275102 1749 + -14         Phage minor capsid protein locus|lin1269, protein_id|NP_470606.1, gi|16800338, geneID|1129842
1302 1275104 1275385 282 + 1         hypothetical protein  
1303 1275480 1276574 1095 + 94         Phage-like element PBSX protein XkdF locus|lin1270, protein_id|NP_470607.1, gi|16800339, geneID|1129843
1304 1276590 1277519 930 + 15 4     Phage-like element PBSX protein XkdG locus|lin1271, protein_id|NP_470608.1, gi|16800340, geneID|1129844
1305 1277525 1277737 213 + 5         hypothetical protein locus|lin1272, protein_id|NP_470609.1, gi|16800341, geneID|1129846
1306 1277749 1278153 405 + 11         Uncharacterized protein YqbG locus|lin1273, protein_id|NP_470610.1, gi|16800342, geneID|1129847
1307 1278155 1278514 360 + 1         Phage-like element PBSX protein XkdH locus|lin1274, protein_id|NP_470611.1, gi|16800343, geneID|1129849

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1300 Phage-like element PBSX protein XkdE
MANKSRARVVKAEKNNTLSNQISKEDAFNGIYGDDSQVIRPPYNLEELSKITENSTVLQQ
CIDAYTTNLFGFGIDAESRLDLNSKDMTPEKKAKAESETKRLQEFIRYANLDEGTETVFQ
NIIEDQEKTGNGYIEVLRDGKGQPVELVHCDSQYIRVCKKTEPVEVGYTIMEKGEPVNIL
RNKRFRKFVQIIDEKKVWFKEYGDPRIMDSTNGNYVEESELESKEFRDATEIIHFKIGTS
AYGVPRWIGNVVSLYGARKAEELNLLYFVNGRHVPAAVVVQGGLLDEDAYNNLEEYMKGV
SGTENAYQFLVLEVQGEEITNANGDKNLSDVKVEIKSLADMIQKDAMFLEYDATHRKKMR
SSFRLPPIYTGEADEYNKATAETARKTTEEQVFQPMRRKLARKINGAFLEALDISEAKLV
LKSPDLTDIASISNAIYPFISAASVIPNDLRPMLEKLLNRKLDELPEEYNKPISILLAEM
QGQSNEHTVSEPKTVQKSLSEYDNVLVMKQMRDLLQELKDNGKL

MD5 = e6c4030058dfb53801bd6a64f126af42


  DNA Sequence

>fig|272626.9.peg.1300 Phage-like element PBSX protein XkdE
gtggcaaataaaagtagagcgcgagtagtaaaagcagaaaaaaataatacactatcaaac
caaatttccaaagaagatgcatttaatggtatatacggtgatgacagccaagtaattaga
ccaccatataatttagaagaactatctaaaataacagagaattcgactgtattacaacaa
tgtattgatgcttatactactaatctctttggctttggcatagatgcagagtccagatta
gatttaaatagcaaagatatgacaccggaaaagaaagctaaagcagaaagtgaaacaaaa
agacttcaagagttcatacgttatgcaaatctcgatgaaggaacagaaactgtgtttcaa
aatattatcgaggatcaagagaaaacaggaaatggttatattgaagtgttacgagatggc
aaaggtcaacctgtagagttagtacattgtgatagtcaatatattcgagtatgtaaaaaa
acagagccagtagaagtgggatacacaatcatggaaaaaggggagccggttaatattttg
cggaataagcgattccgtaaatttgtgcaaattattgatgaaaaaaaagtttggtttaaa
gagtacggtgatccacgaataatggatagtaccaatgggaactatgtggaagaatcagaa
ttagaatcaaaagaatttcgtgatgctacggaaattattcatttcaaaatcgggacctct
gcctatggggttcctcgatggattggtaacgtagttagtctttatggcgcaagaaaggca
gaggaattaaatctcttgtactttgttaatgggcgtcacgttccagctgctgttgttgtt
cagggtggcttgctagatgaagatgcatataacaacttagaagagtacatgaaaggtgtc
tcagggactgaaaatgcctatcaattcttagttttagaagttcaaggggaagagataaca
aatgctaatggtgataaaaacttatctgatgtaaaagtagaaataaaatcattggcagat
atgattcaaaaggacgcaatgtttttagaatatgatgcaacacacaggaaaaaaatgcgt
tcttctttccgattgccgccaatttatacaggtgaagcggacgaatataataaggccact
gcagaaacagcacggaagacgacggaagaacaagtattccaaccgatgcgtagaaagttg
gccaggaagataaatggtgcttttttagaggcgttagatatatctgaagccaaattagta
ttaaaaagtcctgatcttacagatattgcttcaatatccaatgctatatatccatttatc
tcagcagcatccgtcattcctaatgatttgcgtccaatgcttgaaaaattattgaatagg
aagctagatgaattacctgaggaatacaacaaaccaatatctattcttctcgcagaaatg
caaggacaatctaatgaacatactgtttcggaaccgaagacagttcaaaaatcactatct
gaatacgataacgtattagtaatgaaacagatgagagatttgttacaggagttgaaggac
aatggtaaactatga


  DNA with Flanking Sequence

>fig|272626.9.peg.1300 Phage-like element PBSX protein XkdE
aatggattttggttttgttgagtccatgaatgcattactcagtatgacaatagaccctga
caagaaagatttatatattcactttgaatattatgcaaatgggaatacggatgatgtgac
ggctcaagatataaaggaatttaaagagacaaaagaagtaatttttgctgattccgcaga
gccgaaaacaattaaatactttagtgataatggatttgttatgtatgcagctcacaaatt
tccagggtcacgtttacaaaacacaaaaaaggttaaacggttcagacatatttatgtatc
aagtaactgtagcaacactataaacgaattaaagcatttaacttttgctaaagataaatt
aggaaaaactattgaggatgaatttaatattgatccacatacatttagtgcgatttggta
tgggctggacggttatgaagtagctgatattaaagacaaaacagaccgtagtaggcgagc
aagaagggagcgaagaaaacgtggcaaataaaagtagagcgcgagtagtaaaagcagaaa
aaaataatacactatcaaaccaaatttccaaagaagatgcatttaatggtatatacggtg
atgacagccaagtaattagaccaccatataatttagaagaactatctaaaataacagaga
attcgactgtattacaacaatgtattgatgcttatactactaatctctttggctttggca
tagatgcagagtccagattagatttaaatagcaaagatatgacaccggaaaagaaagcta
aagcagaaagtgaaacaaaaagacttcaagagttcatacgttatgcaaatctcgatgaag
gaacagaaactgtgtttcaaaatattatcgaggatcaagagaaaacaggaaatggttata
ttgaagtgttacgagatggcaaaggtcaacctgtagagttagtacattgtgatagtcaat
atattcgagtatgtaaaaaaacagagccagtagaagtgggatacacaatcatggaaaaag
gggagccggttaatattttgcggaataagcgattccgtaaatttgtgcaaattattgatg
aaaaaaaagtttggtttaaagagtacggtgatccacgaataatggatagtaccaatggga
actatgtggaagaatcagaattagaatcaaaagaatttcgtgatgctacggaaattattc
atttcaaaatcgggacctctgcctatggggttcctcgatggattggtaacgtagttagtc
tttatggcgcaagaaaggcagaggaattaaatctcttgtactttgttaatgggcgtcacg
ttccagctgctgttgttgttcagggtggcttgctagatgaagatgcatataacaacttag
aagagtacatgaaaggtgtctcagggactgaaaatgcctatcaattcttagttttagaag
ttcaaggggaagagataacaaatgctaatggtgataaaaacttatctgatgtaaaagtag
aaataaaatcattggcagatatgattcaaaaggacgcaatgtttttagaatatgatgcaa
cacacaggaaaaaaatgcgttcttctttccgattgccgccaatttatacaggtgaagcgg
acgaatataataaggccactgcagaaacagcacggaagacgacggaagaacaagtattcc
aaccgatgcgtagaaagttggccaggaagataaatggtgcttttttagaggcgttagata
tatctgaagccaaattagtattaaaaagtcctgatcttacagatattgcttcaatatcca
atgctatatatccatttatctcagcagcatccgtcattcctaatgatttgcgtccaatgc
ttgaaaaattattgaataggaagctagatgaattacctgaggaatacaacaaaccaatat
ctattcttctcgcagaaatgcaaggacaatctaatgaacatactgtttcggaaccgaaga
cagttcaaaaatcactatctgaatacgataacgtattagtaatgaaacagatgagagatt
tgttacaggagttgaaggacaatggtaaactatgacgctatagataaccttatcgatact
atcaatatattagtagagaaggttaatgaaggagaattcgaaaaagaactacttggacaa
ctaggaatgaaaaatattcccgcatttgttgagacgttcgagaaggacatttctagcctt
cttctaatccagaggtcttattatattaatcaacttaaaaaaactgtaataaaggcagaa
aaaccacttacgattgaagaattatttcaatactactctaatgatttgtttataggtgat
gattttagaataaatatgtctaaaaaagcatctgattttcttacagcaacaacaaaagac
attagtaaaactgttatgaagtcactagataaagatgtctctttcaaacgtttatctgga
cgttctgtgagctggattaaagaatggtcagaggatttggccaacctaatgaaaattagt
actcaatccgaagtagagggggtgctaataaaggcactgagtgaagggaaaggta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01LI1321 Listeria innocua CLIP 11262     phage-like element pbsx protein xkde
emb|CAC96499.1 Listeria innocua EMBL   lin1268
fig|272626.1.peg.1258 Listeria innocua Clip11262 FIG   Phage-like element PBSX protein XkdE
gi|16413742 Listeria innocua NCBI   lin1268
gi|16800337 Listeria innocua Clip11262 NCBI   hypothetical protein lin1268
img|637223996 Listeria innocua Clip11262 IMG   hypothetical protein
kegg|lin:lin1268 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_470605.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1268
tr|Q92CC1 Listeria innocua TrEMBL   Lin1268 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|272626.9.peg.1304 Phage-like element PBSX protein XkdG


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search