The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1299: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: Phage terminase, large subunit ## PBSX family
Translate Function Assignments



Context on contig NC_003212 from base 1265438 to 1277519 (12082 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1292 1265438 1266205 768 +           Phage antirepressor protein locus|lin1260, protein_id|NP_470597.1, gi|16800329, geneID|1129829
1293 1266855 1267334 480 + 649         hypothetical protein locus|lin1261, protein_id|NP_470598.1, gi|16800330, geneID|1129831
1294 1267399 1268736 1338 + 64     1: 1   Phage DNA modification methylase locus|lin1262, protein_id|NP_470599.1, gi|16800331, geneID|1129832
1295 1268784 1268981 198 + 47         hypothetical protein locus|lin1263, protein_id|NP_470600.1, gi|16800332, geneID|1129833
1296 1269111 1269341 231 + 129         FIG00774828: hypothetical protein locus|lin1264, protein_id|NP_470601.1, gi|16800333, geneID|1129834
1297 1269369 1269593 225 + 27         hypothetical protein locus|lin1265, protein_id|NP_470602.1, gi|16800334, geneID|1129835
1298 1269646 1270482 837 + 52         Phage terminase, small subunit locus|lin1266, protein_id|NP_470603.1, gi|16800335, geneID|1129836
1299 1270469 1271803 1335 + -14         Phage terminase, large subunit ## PBSX family locus|lin1267, protein_id|NP_470604.1, gi|16800336, geneID|1129838
1300 1271793 1273367 1575 + -11         Phage-like element PBSX protein XkdE locus|lin1268, protein_id|NP_470605.1, gi|16800337, geneID|1129840
1301 1273354 1275102 1749 + -14         Phage minor capsid protein locus|lin1269, protein_id|NP_470606.1, gi|16800338, geneID|1129842
1302 1275104 1275385 282 + 1         hypothetical protein  
1303 1275480 1276574 1095 + 94         Phage-like element PBSX protein XkdF locus|lin1270, protein_id|NP_470607.1, gi|16800339, geneID|1129843
1304 1276590 1277519 930 + 15         Phage-like element PBSX protein XkdG locus|lin1271, protein_id|NP_470608.1, gi|16800340, geneID|1129844

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1299 Phage terminase, large subunit ## PBSX family
MVEANVVDLVVNPHFEEYVFDWTQKTFLAVGAYGSSKSYATAEKIIIKLFEEKRKCLVVR
DVHESHKDSTFALLTEILEEMGVVGRGKRKVVITQSPMKIKFPNGSSIIFKGLDKPSKLK
SIANISIIWVEECSEISYAAYKELLGRLRHPFLKTHIILTSNPVSIDNWVYLHFFEDFIN
KRFILSDSLLYEKRIIKKNNTYYHHSVAEDNYFLTQDYIDDLEDMKNYDPDLYRVARQGR
FGVLGTKVLPQLEEKDHDWMIEAINNIKNPINRNGMDFGFVESMNALLSMTIDPDKKDLY
IHFEYYANGNTDDVTAQDIKEFKETKEVIFADSAEPKTIKYFSDNGFVMYAAHKFPGSRL
QNTKKVKRFRHIYVSSNCSNTINELKHLTFAKDKLGKTIEDEFNIDPHTFSAIWYGLDGY
EVADIKDKTDRSRRARRERRKRGK

MD5 = 6d039402eb362ae3c1cf24d7ccdf0c9a


  DNA Sequence

>fig|272626.9.peg.1299 Phage terminase, large subunit ## PBSX family
ttggtagaagctaatgtagttgatttagtcgttaaccctcattttgaggagtacgtattt
gattggacacaaaaaacatttcttgctgtaggtgcttatggttcgagtaaaagctatgca
acagctgaaaaaattataataaaattatttgaagaaaaacgaaaatgcttagttgttagg
gatgttcacgaatcgcacaaggattctactttcgctttattaactgaaatccttgaggaa
atgggtgttgttgggagaggtaaaaggaaagttgtaattactcaaagtcctatgaaaata
aaatttcctaatgggtcatccataatttttaaaggattggataaacctagtaagttaaag
tctatagctaatatttctattatttgggtagaagagtgctcagagattagttatgctgca
tacaaagaacttttaggacggttaagacatccgtttttaaaaacacatattattttaact
tcaaaccctgtcagtatagataattgggtctatttacatttctttgaggacttcataaac
aaacgttttatattgagtgattcgttattatatgaaaagcgaattattaaaaagaataat
acgtattatcatcatagcgttgctgaagataattattttttaactcaagattatattgat
gacttagaagatatgaagaattatgatcctgatttatatcgagttgctcggcaaggcaga
tttggtgtgcttggtactaaagttcttccgcagttagaagagaaggaccacgactggatg
atagaagccatcaataacattaagaatccaattaatcgaaatggaatggattttggtttt
gttgagtccatgaatgcattactcagtatgacaatagaccctgacaagaaagatttatat
attcactttgaatattatgcaaatgggaatacggatgatgtgacggctcaagatataaag
gaatttaaagagacaaaagaagtaatttttgctgattccgcagagccgaaaacaattaaa
tactttagtgataatggatttgttatgtatgcagctcacaaatttccagggtcacgttta
caaaacacaaaaaaggttaaacggttcagacatatttatgtatcaagtaactgtagcaac
actataaacgaattaaagcatttaacttttgctaaagataaattaggaaaaactattgag
gatgaatttaatattgatccacatacatttagtgcgatttggtatgggctggacggttat
gaagtagctgatattaaagacaaaacagaccgtagtaggcgagcaagaagggagcgaaga
aaacgtggcaaataa


  DNA with Flanking Sequence

>fig|272626.9.peg.1299 Phage terminase, large subunit ## PBSX family
ctttagcgatgaagaaaaaaaaatatacaattctctgacagaccaccccctagcccacgc
taataatatcattaaagatgaatatattcggaaaagaagaatgatgaaacgactaaacga
attagaaaataatttgtcggagtctgaaaaagagataaaaaaagcttacttaaaacaaga
tataagaaaagttattgaaagagacggacagaaagcaattatgacagttcctgagctagt
acttgttgaacaaaaagaagaaactaaacgtaagatagatgatgttttacggctagaaga
atctattacaagacaaaacggtgttttacttagagcattgagagacaagtctgcaataat
tgctcagctatctatgctaccgctcaatcaagaaaaaacacaaaaagaaatcgaaatgct
agaactcgaaatacaagagcttaaaggtatagacttagaaaaaccgcttgaaattagagt
ctcaagggcggtgaagaaacttggtagaagctaatgtagttgatttagtcgttaaccctc
attttgaggagtacgtatttgattggacacaaaaaacatttcttgctgtaggtgcttatg
gttcgagtaaaagctatgcaacagctgaaaaaattataataaaattatttgaagaaaaac
gaaaatgcttagttgttagggatgttcacgaatcgcacaaggattctactttcgctttat
taactgaaatccttgaggaaatgggtgttgttgggagaggtaaaaggaaagttgtaatta
ctcaaagtcctatgaaaataaaatttcctaatgggtcatccataatttttaaaggattgg
ataaacctagtaagttaaagtctatagctaatatttctattatttgggtagaagagtgct
cagagattagttatgctgcatacaaagaacttttaggacggttaagacatccgtttttaa
aaacacatattattttaacttcaaaccctgtcagtatagataattgggtctatttacatt
tctttgaggacttcataaacaaacgttttatattgagtgattcgttattatatgaaaagc
gaattattaaaaagaataatacgtattatcatcatagcgttgctgaagataattattttt
taactcaagattatattgatgacttagaagatatgaagaattatgatcctgatttatatc
gagttgctcggcaaggcagatttggtgtgcttggtactaaagttcttccgcagttagaag
agaaggaccacgactggatgatagaagccatcaataacattaagaatccaattaatcgaa
atggaatggattttggttttgttgagtccatgaatgcattactcagtatgacaatagacc
ctgacaagaaagatttatatattcactttgaatattatgcaaatgggaatacggatgatg
tgacggctcaagatataaaggaatttaaagagacaaaagaagtaatttttgctgattccg
cagagccgaaaacaattaaatactttagtgataatggatttgttatgtatgcagctcaca
aatttccagggtcacgtttacaaaacacaaaaaaggttaaacggttcagacatatttatg
tatcaagtaactgtagcaacactataaacgaattaaagcatttaacttttgctaaagata
aattaggaaaaactattgaggatgaatttaatattgatccacatacatttagtgcgattt
ggtatgggctggacggttatgaagtagctgatattaaagacaaaacagaccgtagtaggc
gagcaagaagggagcgaagaaaacgtggcaaataaaagtagagcgcgagtagtaaaagca
gaaaaaaataatacactatcaaaccaaatttccaaagaagatgcatttaatggtatatac
ggtgatgacagccaagtaattagaccaccatataatttagaagaactatctaaaataaca
gagaattcgactgtattacaacaatgtattgatgcttatactactaatctctttggcttt
ggcatagatgcagagtccagattagatttaaatagcaaagatatgacaccggaaaagaaa
gctaaagcagaaagtgaaacaaaaagacttcaagagttcatacgttatgcaaatctcgat
gaaggaacagaaactgtgtttcaaaatattatcgaggatcaagagaaaacaggaaatggt
tatattgaagtgttacgagatggcaaaggtcaacctgtagagttagtacattgtgatagt
caatatattcgagtatgtaaaaaaacagagccagtagaagtgggatacacaatca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006323       P:DNA packaging
cmr|NT01LI1320 Listeria innocua CLIP 11262     conserved hypothetical protein
emb|CAC96498.1 Listeria innocua EMBL   lin1267
fig|272626.1.peg.1257 Listeria innocua Clip11262 FIG   Phage terminase, large subunit ## PBSX family
gi|16413741 Listeria innocua NCBI   lin1267
gi|16800336 Listeria innocua Clip11262 NCBI   hypothetical protein lin1267
img|637223995 Listeria innocua Clip11262 IMG   hypothetical protein
kegg|lin:lin1267 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_470604.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1267
tr|Q92CC2 Listeria innocua TrEMBL   Lin1267 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search