The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1297: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_003212 from base 1264362 to 1275102 (10741 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1290 1264362 1264922 561 +           FIG00774160: hypothetical protein locus|lin1258, protein_id|NP_470595.1, gi|16800327, geneID|1129827
1291 1265003 1265425 423 + 80         hypothetical protein locus|lin1259, protein_id|NP_470596.1, gi|16800328, geneID|1129828
1292 1265438 1266205 768 + 12         Phage antirepressor protein locus|lin1260, protein_id|NP_470597.1, gi|16800329, geneID|1129829
1293 1266855 1267334 480 + 649         hypothetical protein locus|lin1261, protein_id|NP_470598.1, gi|16800330, geneID|1129831
1294 1267399 1268736 1338 + 64     1: 1   Phage DNA modification methylase locus|lin1262, protein_id|NP_470599.1, gi|16800331, geneID|1129832
1295 1268784 1268981 198 + 47         hypothetical protein locus|lin1263, protein_id|NP_470600.1, gi|16800332, geneID|1129833
1296 1269111 1269341 231 + 129         FIG00774828: hypothetical protein locus|lin1264, protein_id|NP_470601.1, gi|16800333, geneID|1129834
1297 1269369 1269593 225 + 27         hypothetical protein locus|lin1265, protein_id|NP_470602.1, gi|16800334, geneID|1129835
1298 1269646 1270482 837 + 52         Phage terminase, small subunit locus|lin1266, protein_id|NP_470603.1, gi|16800335, geneID|1129836
1299 1270469 1271803 1335 + -14         Phage terminase, large subunit ## PBSX family locus|lin1267, protein_id|NP_470604.1, gi|16800336, geneID|1129838
1300 1271793 1273367 1575 + -11         Phage-like element PBSX protein XkdE locus|lin1268, protein_id|NP_470605.1, gi|16800337, geneID|1129840
1301 1273354 1275102 1749 + -14         Phage minor capsid protein locus|lin1269, protein_id|NP_470606.1, gi|16800338, geneID|1129842

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1297 hypothetical protein
MTLIFWTKNGQEMEFDLVENVEIDEKIITFDYYGEGEKRGVVFILNNLAGMAVEDENSES
ESKDGASWFKVYRG

MD5 = d40ba617588f69af5d1573a80b3cf54e


  DNA Sequence

>fig|272626.9.peg.1297 hypothetical protein
atgacccttatattttggactaaaaatggacaagagatggaatttgatctagttgaaaat
gtagagattgacgagaaaattattacattcgattactatggagaaggtgaaaaaagaggc
gtagtgtttatattaaataatcttgctggcatggctgtagaggatgagaattcggagagt
gaaagtaaagatggtgcatcttggtttaaagtgtacaggggttaa


  DNA with Flanking Sequence

>fig|272626.9.peg.1297 hypothetical protein
ctaagaaacaaataattccatacgcggaagcttttaatactagatcgaaagagattgcta
aaaagtataatcaaaagcctaaattactttcagtagcagcgtttttaagataaaaaagaa
gaggtgcgttaacaccccttcccatagagccatcactggccatgagatagcaaacagacc
tcgcgaggttttagacattgctatctctttttctattctaatagaaagctggtgaaaagg
caatgaaaaaggagaacgagcgttcggttgatgggaacttaaatgatgatttattagatt
tagagataactaaagctcttgaagaagctaaaacagatgaagaatacaaaaaaattattc
gagctacgctggggaagtggcttaataatctacaagaaggcaatatacgtcttgaatctg
taaatgaccttaaaaccctcattgaagcagatagattactaagaagagattaacttttat
tgaaagattggagaataaacatgacccttatattttggactaaaaatggacaagagatgg
aatttgatctagttgaaaatgtagagattgacgagaaaattattacattcgattactatg
gagaaggtgaaaaaagaggcgtagtgtttatattaaataatcttgctggcatggctgtag
aggatgagaattcggagagtgaaagtaaagatggtgcatcttggtttaaagtgtacaggg
gttaagtaaagtaaaaacgaacataaacataagtaatggtggtgacgttgatgtgtcatg
gataacctagataaagagctcataaaaaaagactatttggcaggaatgaagaacaaagaa
atagtagaaaaatatggcatatctccgaataccttgaaggcgtggattagaagatatggt
tggaaagatgaaaaagaaaagggtgcatccaaaacaaaaaaaatgggcgcaccctttgga
aatgtaaacgcaaaagggaattcgggcggtggggcacctttaggcaataaaaacgcgata
ggtaactctggcgggggtgcaccctttggtaataagaatgcactttttacaggagagttc
gaaattattgatcctgattactttagcgatgaagaaaaaaaaatatacaattctctgaca
gaccaccccctagcccacgctaataatatcattaaagatgaatatattcggaaaagaaga
atgatgaaacgactaaacgaattag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01LI1318 Listeria innocua CLIP 11262     hypothetical protein
cmr|NT01LI1799 Listeria innocua CLIP 11262     hypothetical protein
emb|CAC96496.1 Listeria innocua EMBL   lin1265
emb|CAC96965.1 Listeria innocua EMBL   lin1734
fig|272626.1.peg.1255 Listeria innocua Clip11262 FIG   hypothetical protein
fig|272626.1.peg.1723 Listeria innocua Clip11262 FIG   hypothetical protein
fig|272626.9.peg.1771 Listeria innocua Clip11262 FIG   hypothetical protein
fig|330397.2.peg.80 Siphoviridae Listeria phage B054 FIG   hypothetical protein
gb|AAY53185.1 Listeria phage B054     gp80
gi|157325364 Listeria phage B054 NCBI   gp80
gi|16413739 Listeria innocua NCBI   lin1265
gi|16414221 Listeria innocua NCBI   lin1734
gi|16800334 Listeria innocua Clip11262 NCBI   hypothetical protein lin1265
gi|16800802 Listeria innocua Clip11262 NCBI   hypothetical protein lin1734
gi|20140652 organism not parsed/found in ncbi nr NCBI   Uncharacterized protein Lin1265/Lin1734
gi|66733369 Listeria phage B054 NCBI   gp80
img|637223993 Listeria innocua Clip11262 IMG   hypothetical protein
img|637224461 Listeria innocua Clip11262 IMG   hypothetical protein
img|641510161 Listeria phage B054 IMG   gp80
kegg|lin:lin1265 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
kegg|lin:lin1734 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_470602.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1265
ref|NP_471070.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1734
ref|YP_001468784.1 Listeria phage B054 RefSeq   gp80
sp|Q926B0 Listeria innocua SwissProt   Uncharacterized protein Lin1265/Lin1734
sp|Y1265_LISIN organism not parsed/found in ncbi nr SwissProt   Uncharacterized protein Lin1265/Lin1734
tr|A8ATN8 Listeria phage B054 TrEMBL   Gp80


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search