The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on aspen.cels.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1294: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: Phage DNA modification methylase
Translate Function Assignments



Context on contig NC_003212 from base 1262385 to 1275102 (12718 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1286 1262385 1263065 681 +           FIG00775669: hypothetical protein locus|lin1255, protein_id|NP_470592.1, gi|16800324, geneID|1129823
1287 1263062 1263355 294 + -4         hypothetical protein locus|lin1256, protein_id|NP_470593.1, gi|16800325, geneID|1129825
1288 1263491 1263643 153 + 135         hypothetical protein  
1289 1264293 1263766 528 - 122         conserved hypothetical protein locus|lin1257, protein_id|NP_470594.1, gi|16800326, geneID|1129826
1290 1264362 1264922 561 + 68         FIG00774160: hypothetical protein locus|lin1258, protein_id|NP_470595.1, gi|16800327, geneID|1129827
1291 1265003 1265425 423 + 80         hypothetical protein locus|lin1259, protein_id|NP_470596.1, gi|16800328, geneID|1129828
1292 1265438 1266205 768 + 12         Phage antirepressor protein locus|lin1260, protein_id|NP_470597.1, gi|16800329, geneID|1129829
1293 1266855 1267334 480 + 649         hypothetical protein locus|lin1261, protein_id|NP_470598.1, gi|16800330, geneID|1129831
1294 1267399 1268736 1338 + 64     1: 1   Phage DNA modification methylase locus|lin1262, protein_id|NP_470599.1, gi|16800331, geneID|1129832
1295 1268784 1268981 198 + 47         hypothetical protein locus|lin1263, protein_id|NP_470600.1, gi|16800332, geneID|1129833
1296 1269111 1269341 231 + 129         FIG00774828: hypothetical protein locus|lin1264, protein_id|NP_470601.1, gi|16800333, geneID|1129834
1297 1269369 1269593 225 + 27         hypothetical protein locus|lin1265, protein_id|NP_470602.1, gi|16800334, geneID|1129835
1298 1269646 1270482 837 + 52         Phage terminase, small subunit locus|lin1266, protein_id|NP_470603.1, gi|16800335, geneID|1129836
1299 1270469 1271803 1335 + -14         Phage terminase, large subunit ## PBSX family locus|lin1267, protein_id|NP_470604.1, gi|16800336, geneID|1129838
1300 1271793 1273367 1575 + -11         Phage-like element PBSX protein XkdE locus|lin1268, protein_id|NP_470605.1, gi|16800337, geneID|1129840
1301 1273354 1275102 1749 + -14         Phage minor capsid protein locus|lin1269, protein_id|NP_470606.1, gi|16800338, geneID|1129842

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DGQHR-like Joseph_Jennifer_user Adenine-specific methyltransferase (EC 2.1.1.72)


  Protein Sequence

>fig|272626.9.peg.1294 Phage DNA modification methylase
MIIKEIEVSKINPAPYNPRMDLQPNDPEYQKLKKSIEEFGYIDPLIWNKKTGNLVGGHQR
FKILLEENPERLTVSVVDLDINQEKALNIALNKIEGGWSTDKLGELLKSINDEEMLNLTG
FSALEIDELIKEFELPPATVDKVKENPLDSNLFESFLFPPFSYLDSKTKRWRDRKDQWKN
LGIRSELGREGNLTFASSLRSASLTGTSIFDPVLCELAYRWFTPGESAKIYDPFAGGSVR
GIVAKVLGHEYTGIDLRKEQVEANRINAKEIGLDGINWITDNSLNADKHIEDNSMDLLFT
CPPYFDLEVYSDNKEDISNMEYEEFIKVYSEILAKGANKLKDNRFAIVVISDVRDKAGFY
RDLTGLTKSVFEKNGIYFYNDLILLNSLGSGALRARRNMRNRKLVRIHQNVLVFYKGNPD
EIQEHFPILEVLEDNLEEALESIDI

MD5 = 5720530b0e17e3d51609f4f0a2737604


  DNA Sequence

>fig|272626.9.peg.1294 Phage DNA modification methylase
atgattatcaaagaaatagaagtaagcaaaattaacccagcaccatacaatccgagaatg
gatttacagccaaacgatccagaatatcaaaaattaaaaaaatcaattgaagagtttggc
tatatcgatccgttaatctggaacaagaaaactggtaatttggttggtggccatcagcgt
tttaaaattttacttgaggaaaatccggaaaggttgactgtatcagtagttgaccttgat
ataaatcaagagaaagcattgaatattgctttaaataaaatagaaggcggatggagtact
gataaattaggcgaattactaaaaagcattaatgatgaagaaatgctaaatttaacagga
ttctcagcacttgaaatagatgaattaattaaagaattcgaattacctccagctactgtg
gataaagtaaaagaaaacccgttagactcgaatctgttcgagtcttttttgtttcctcct
ttttcgtatttagattcaaaaacaaagaggtggagggataggaaggaccaatggaaaaat
ttagggattagaagcgaattaggtcgagaaggtaatctcacgtttgcatctagcttgcgg
tcagcaagtttgacaggaacgagtattttcgaccccgtactttgcgagttggcttacaga
tggtttactcctggagaatctgccaaaatatacgatccattcgctggcggctctgttcgg
ggtattgtggcaaaagtgcttggccacgaatatactggaattgatttaagaaaagaacaa
gtagaagctaaccgcattaatgctaaagaaatcggattagatggcattaattggattacc
gataatagcttaaacgcggataaacatattgaagataactcgatggacttattatttaca
tgcccaccttactttgatttagaagtatattcagataataaagaagacattagcaacatg
gaatacgaggaatttattaaagtgtactccgagatattggcgaagggtgcgaataaatta
aaagataatcgatttgccattgtggttatttcagatgtacgagataaagcaggtttttat
agagatttgacaggtcttactaaatcggtatttgagaagaatggtatttacttctataat
gacttgattttgttaaactcactaggctcaggagcattaagagctcgcagaaatatgcgt
aacaggaagttagtccgtattcaccagaatgttttagtgttttataaaggaaatcctgat
gagatacaagaacatttccccattttagaggtactggaagataatttagaagaagcgctt
gaatctatcgacatttaa


  DNA with Flanking Sequence

>fig|272626.9.peg.1294 Phage DNA modification methylase
attactagcggttggaacgtcattgtatttggctaacaggaaccccaagaaaaaattatt
agtttcacatgaaattaaagagataggaactttagcaacggtttctgattataacataga
aacattagttgtaactgtcgcaaacttggaaattacttcagtacaaataagagatttatt
ttttgtttcagaatcaatacgaataaaattaccactaagtgcgctggttggttttgctgc
aatgggtaaaactactccatgcgttgttgatccattttcagaagttaggttcttggtgat
ttataatgattttcaaagtctgttaaaagaaaaaaatgcaagaggaatcattacggggga
aatattggttgtagatgaatcaaataaaaagcatagagataaagtcaaattaactattga
agttgttgatatgtaaatatcattagtggaaaaagagctagaagagccaataaggctctt
tttttattggaggaaataaaatgattatcaaagaaatagaagtaagcaaaattaacccag
caccatacaatccgagaatggatttacagccaaacgatccagaatatcaaaaattaaaaa
aatcaattgaagagtttggctatatcgatccgttaatctggaacaagaaaactggtaatt
tggttggtggccatcagcgttttaaaattttacttgaggaaaatccggaaaggttgactg
tatcagtagttgaccttgatataaatcaagagaaagcattgaatattgctttaaataaaa
tagaaggcggatggagtactgataaattaggcgaattactaaaaagcattaatgatgaag
aaatgctaaatttaacaggattctcagcacttgaaatagatgaattaattaaagaattcg
aattacctccagctactgtggataaagtaaaagaaaacccgttagactcgaatctgttcg
agtcttttttgtttcctcctttttcgtatttagattcaaaaacaaagaggtggagggata
ggaaggaccaatggaaaaatttagggattagaagcgaattaggtcgagaaggtaatctca
cgtttgcatctagcttgcggtcagcaagtttgacaggaacgagtattttcgaccccgtac
tttgcgagttggcttacagatggtttactcctggagaatctgccaaaatatacgatccat
tcgctggcggctctgttcggggtattgtggcaaaagtgcttggccacgaatatactggaa
ttgatttaagaaaagaacaagtagaagctaaccgcattaatgctaaagaaatcggattag
atggcattaattggattaccgataatagcttaaacgcggataaacatattgaagataact
cgatggacttattatttacatgcccaccttactttgatttagaagtatattcagataata
aagaagacattagcaacatggaatacgaggaatttattaaagtgtactccgagatattgg
cgaagggtgcgaataaattaaaagataatcgatttgccattgtggttatttcagatgtac
gagataaagcaggtttttatagagatttgacaggtcttactaaatcggtatttgagaaga
atggtatttacttctataatgacttgattttgttaaactcactaggctcaggagcattaa
gagctcgcagaaatatgcgtaacaggaagttagtccgtattcaccagaatgttttagtgt
tttataaaggaaatcctgatgagatacaagaacatttccccattttagaggtactggaag
ataatttagaagaagcgcttgaatctatcgacatttaaacgtatatcccttacagtaaca
gcataaaggaaacggagtggtgtacatgagagaagatattcaacgattaaaagataaagc
ggacacagctaaaatgaaatatcatcgaaatataattgatagagaaacagctaagaaaca
aataattccatacgcggaagcttttaatactagatcgaaagagattgctaaaaagtataa
tcaaaagcctaaattactttcagtagcagcgtttttaagataaaaaagaagaggtgcgtt
aacaccccttcccatagagccatcactggccatgagatagcaaacagacctcgcgaggtt
ttagacattgctatctctttttctattctaatagaaagctggtgaaaaggcaatgaaaaa
ggagaacgagcgttcggttgatgggaacttaaatgatgatttattagatttagagataac
taaagctcttgaagaagctaaaacagatgaagaatacaaaaaaattattcgagctacg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search