The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1291: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_003212 from base 1259830 to 1270482 (10653 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1283 1259830 1261191 1362 +           FIG00776219: hypothetical protein locus|lin1253, protein_id|NP_470590.1, gi|16800322, geneID|1129821
1284 1261204 1261428 225 + 12         hypothetical protein  
1285 1261428 1262372 945 + -1         Phage integrase locus|lin1254, protein_id|NP_470591.1, gi|16800323, geneID|1129822
1286 1262385 1263065 681 + 12         FIG00775669: hypothetical protein locus|lin1255, protein_id|NP_470592.1, gi|16800324, geneID|1129823
1287 1263062 1263355 294 + -4         hypothetical protein locus|lin1256, protein_id|NP_470593.1, gi|16800325, geneID|1129825
1288 1263491 1263643 153 + 135         hypothetical protein  
1289 1264293 1263766 528 - 122         conserved hypothetical protein locus|lin1257, protein_id|NP_470594.1, gi|16800326, geneID|1129826
1290 1264362 1264922 561 + 68         FIG00774160: hypothetical protein locus|lin1258, protein_id|NP_470595.1, gi|16800327, geneID|1129827
1291 1265003 1265425 423 + 80         hypothetical protein locus|lin1259, protein_id|NP_470596.1, gi|16800328, geneID|1129828
1292 1265438 1266205 768 + 12         Phage antirepressor protein locus|lin1260, protein_id|NP_470597.1, gi|16800329, geneID|1129829
1293 1266855 1267334 480 + 649         hypothetical protein locus|lin1261, protein_id|NP_470598.1, gi|16800330, geneID|1129831
1294 1267399 1268736 1338 + 64     1: 1   Phage DNA modification methylase locus|lin1262, protein_id|NP_470599.1, gi|16800331, geneID|1129832
1295 1268784 1268981 198 + 47         hypothetical protein locus|lin1263, protein_id|NP_470600.1, gi|16800332, geneID|1129833
1296 1269111 1269341 231 + 129         FIG00774828: hypothetical protein locus|lin1264, protein_id|NP_470601.1, gi|16800333, geneID|1129834
1297 1269369 1269593 225 + 27         hypothetical protein locus|lin1265, protein_id|NP_470602.1, gi|16800334, geneID|1129835
1298 1269646 1270482 837 + 52         Phage terminase, small subunit locus|lin1266, protein_id|NP_470603.1, gi|16800335, geneID|1129836

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1291 hypothetical protein
MALFELPQINNVRTKRNVIRALEKYKIMRVRLGERRMPKLTSTLTIVPPSFNNEFHSTTE
ESAIWNVDAVNEAKAYVKLIDHHINQLPERSRQVILTKFIEENSDYEAMLAIHVSHSQYK
EEKRKAIERLAYQLNIVVEK

MD5 = eb56abe4127cf388192c7ced795198d0


  DNA Sequence

>fig|272626.9.peg.1291 hypothetical protein
atggcgctgttcgaactaccgcaaattaacaatgttagaacaaaaagaaacgtaataaga
gctttagaaaaatataaaattatgagagttagactcggcgagagaagaatgccaaagtta
acttctacattgaccatagtgccaccatcatttaataatgaattccattctacgacagaa
gaaagtgcaatatggaatgtagatgcagtaaatgaagcaaaagcatatgttaaattgatt
gatcatcacatcaaccaacttcctgaacggagtaggcaagtgatactaactaaattcatt
gaagaaaatagtgattatgaagctatgttggccatacatgtaagtcactcgcagtacaaa
gaagaaaagagaaaagcaattgaacgcctagcctatcagcttaatatagtagttgaaaaa
tga


  DNA with Flanking Sequence

>fig|272626.9.peg.1291 hypothetical protein
actttaaaagtggcgtatgcagttgaagcgaatttaccgggtgatttcagtacagcgaaa
ttatcgaaaatacaagcccgtgacttcataagttccattatagagttttgttttcaattt
gatataccgttatcatcgccaggactgcaaatgacggatgatatcaatagatacctgttc
ttatgtatcaaatacagaaaatgcgctgtaacaggtcatagaggcgaaatacatcatgta
gatgccattggccaaggtagagatagaagaaattatgatcacagtaaatcaagactgatt
tgtttatctcgagaaatgcacacagaagctcaccaaatcggttggctaacgtttataagt
aaataccacgttgatggaataattttaagtccggatgctgtaaaagaattaaatatataa
aaaaagccagagcgaccgctccggcgtggaatgtgattcctagacaaaatcattatacca
caatggaggggttgcgtgtgatggcgctgttcgaactaccgcaaattaacaatgttagaa
caaaaagaaacgtaataagagctttagaaaaatataaaattatgagagttagactcggcg
agagaagaatgccaaagttaacttctacattgaccatagtgccaccatcatttaataatg
aattccattctacgacagaagaaagtgcaatatggaatgtagatgcagtaaatgaagcaa
aagcatatgttaaattgattgatcatcacatcaaccaacttcctgaacggagtaggcaag
tgatactaactaaattcattgaagaaaatagtgattatgaagctatgttggccatacatg
taagtcactcgcagtacaaagaagaaaagagaaaagcaattgaacgcctagcctatcagc
ttaatatagtagttgaaaaatgaggagggaacacaatgaataatttagcagtattagata
aaaataatacattaaacagtcgtgaagttgctgaaatggtagaaaaaaggcactctgatt
tactacgtgatatcgaaacttatattagatatatcaatcaaaacgcaaaactgcgttctg
atgattttttcagtgaatctacttatcaagctggcaccgggaaagattataagtgctatg
aaatcacaaaaatgggctgtgaaatgatagccaataaattaactggggcaaaaggcattc
agtttacagctttatttgtacaaaagttcaacaagttagaagaaaaagaaatgcaaactt
tttatattccaggaacctacgcagaagcacttacacttgcagcaaaacaagctgaactaa
atgagcagttaatgttagaaaatgaagtgaaaacacaaactatagccgaatatgaaccaa
aagtgagttattatgatcagattttaaaatctcctggattaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01LI1311 Listeria innocua CLIP 11262     gp66
cmr|NT01LI1806 Listeria innocua CLIP 11262     gp66
fig|272626.9.peg.1777 Listeria innocua Clip11262 FIG   hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search