The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1287: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_003212 from base 1257766 to 1268736 (10971 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1278 1257766 1258203 438 +           Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) locus|lin1248, protein_id|NP_470585.1, gi|16800317, geneID|1129815
1279 1258225 1258845 621 + 21         FIG00775176: hypothetical protein locus|lin1249, protein_id|NP_470586.1, gi|16800318, geneID|1129816
1280 1258886 1259263 378 + 40         FIG00775670: hypothetical protein locus|lin1250, protein_id|NP_470587.1, gi|16800319, geneID|1129817
1281 1259223 1259399 177 + -41         FIG00774198: hypothetical protein locus|lin1251, protein_id|NP_470588.1, gi|16800320, geneID|1129819
1282 1259411 1259833 423 + 11         FIG00775219: hypothetical protein locus|lin1252, protein_id|NP_470589.1, gi|16800321, geneID|1129820
1283 1259830 1261191 1362 + -4         FIG00776219: hypothetical protein locus|lin1253, protein_id|NP_470590.1, gi|16800322, geneID|1129821
1284 1261204 1261428 225 + 12         hypothetical protein  
1285 1261428 1262372 945 + -1         Phage integrase locus|lin1254, protein_id|NP_470591.1, gi|16800323, geneID|1129822
1286 1262385 1263065 681 + 12         FIG00775669: hypothetical protein locus|lin1255, protein_id|NP_470592.1, gi|16800324, geneID|1129823
1287 1263062 1263355 294 + -4         hypothetical protein locus|lin1256, protein_id|NP_470593.1, gi|16800325, geneID|1129825
1288 1263491 1263643 153 + 135         hypothetical protein  
1289 1264293 1263766 528 - 122         conserved hypothetical protein locus|lin1257, protein_id|NP_470594.1, gi|16800326, geneID|1129826
1290 1264362 1264922 561 + 68         FIG00774160: hypothetical protein locus|lin1258, protein_id|NP_470595.1, gi|16800327, geneID|1129827
1291 1265003 1265425 423 + 80         hypothetical protein locus|lin1259, protein_id|NP_470596.1, gi|16800328, geneID|1129828
1292 1265438 1266205 768 + 12         Phage antirepressor protein locus|lin1260, protein_id|NP_470597.1, gi|16800329, geneID|1129829
1293 1266855 1267334 480 + 649         hypothetical protein locus|lin1261, protein_id|NP_470598.1, gi|16800330, geneID|1129831
1294 1267399 1268736 1338 + 64     1: 1   Phage DNA modification methylase locus|lin1262, protein_id|NP_470599.1, gi|16800331, geneID|1129832

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1287 hypothetical protein
MIKYFEYTRRENYLYALIKAESKKQADFIYWRDVVKCEEEFARTGLITEFNAVELTEKKA
LKLFMSSLQEYETEEEIKQGFYETVNNKILLLDSDLI

MD5 = 5a1a839ccc76eefd59845cdafe6bb12a


  DNA Sequence

>fig|272626.9.peg.1287 hypothetical protein
atgattaaatacttcgaatacacaagaagagaaaactatctttatgcattaattaaagca
gaaagcaaaaaacaagctgattttatttattggcgtgatgttgttaagtgcgaagaagaa
tttgcaagaactggactaataacagaattcaatgccgttgaattaacagagaaaaaagcg
ttaaaactcttcatgtcatctttgcaagaatatgaaacagaggaagaaataaaacaaggt
ttttatgaaactgtcaacaataaaattttactgcttgattccgatttaatttga


  DNA with Flanking Sequence

>fig|272626.9.peg.1287 hypothetical protein
aagtattttgtttatgaaaacgacgacgatattagcaaagctgcagaatttttaggacgt
acaaaagatgcagttataaacagactagtgaagttaagaaaaagagattcttcagtttct
tttattaggcgtccgtggacagaaaaagaagatgagatactaaaaaaaaattatattatt
atgtcaaatgcccaattcgctgaacgattaagaagaacgaaagcctctgtagcaggaaga
aaggtactgttaggactgacaaacaaacacatgtctaaagaagatgacaaaataattcgt
catcttggaaatcaagggtacacaatcaaagagatctcagcagaaatgaatttgtcttat
tgcttagttaaaaactatataagaaatcaccgaatcaattatagaagggaatcaaaaaac
gggatgaacggttggcgaaaagaggcagatgcgacatattcgctttatattaacgctaaa
aaaatcaaggagggccaagcatgattaaatacttcgaatacacaagaagagaaaactatc
tttatgcattaattaaagcagaaagcaaaaaacaagctgattttatttattggcgtgatg
ttgttaagtgcgaagaagaatttgcaagaactggactaataacagaattcaatgccgttg
aattaacagagaaaaaagcgttaaaactcttcatgtcatctttgcaagaatatgaaacag
aggaagaaataaaacaaggtttttatgaaactgtcaacaataaaattttactgcttgatt
ccgatttaatttgagataggaggacgattatatgagtgaaacaactgaaatgattttaga
gggtattttgtgtaggaattgcggagtattcattgatgatgtaaatccgggatatccgag
aacatgcgaagattgcgaggaagataataatgaaaaacggtaaaaagttaactagaaatc
aagcgacgatgataaaaagtaatggtcttaatccagaaaattggttagtagtaaaaaatc
ttaatgatcgaatggaaatagtacatcgagaaacaagaaaaaagcagctaataaaaaaat
agctgaagaaaaggttaattatgcattgatggcatattttggtgaaagatatatgaaaag
taatattttcaaaaaactgcgacatatgagtaatacatgtcgcagtaatacaaataatcg
tatattaaagattgcttttagtatattcatgaagagtatttttaagaatataactttctt
cactatcttttgagtttcttgctgacgcgtatac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01LI1306 Listeria innocua CLIP 11262     hypothetical protein
cmr|NT01LI1811 Listeria innocua CLIP 11262     hypothetical protein
emb|CAC96487.1 Listeria innocua EMBL   lin1256
fig|272626.1.peg.1246 Listeria innocua Clip11262 FIG   hypothetical protein
fig|272626.1.peg.2988 Listeria innocua Clip11262 FIG   hypothetical protein
fig|272626.9.peg.1782 Listeria innocua Clip11262 FIG   hypothetical protein
fig|330397.2.peg.66 Siphoviridae Listeria phage B054 FIG   hypothetical protein
gb|AAY53171.1 Listeria phage B054     gp66
gi|157325350 Listeria phage B054 NCBI   gp66
gi|16413730 Listeria innocua NCBI   lin1256
gi|16800325 Listeria innocua Clip11262 NCBI   hypothetical protein lin1256
gi|66733355 Listeria phage B054 NCBI   gp66
img|637223984 Listeria innocua Clip11262 IMG   hypothetical protein
img|641510147 Listeria phage B054 IMG   gp66
kegg|lin:lin1256 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_470593.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1256
ref|YP_001468770.1 Listeria phage B054 RefSeq   gp66
tr|A8ATM4 Listeria phage B054 TrEMBL   Gp66
tr|Q92CD1 Listeria innocua TrEMBL   Lin1256 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search