The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1283: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: FIG00776219: hypothetical protein
Translate Function Assignments



Context on contig NC_003212 from base 1254779 to 1266205 (11427 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1273 1254779 1255516 738 +       1: 1   Metallo-beta-lactamase superfamily domain protein in prophage locus|lin1243, protein_id|NP_470580.1, gi|16800312, geneID|1129807
1274 1255528 1256445 918 + 11         Phage replication initiation protein locus|lin1244, protein_id|NP_470581.1, gi|16800313, geneID|1129808
1275 1256576 1257184 609 + 130     1: 2   DNA replication protein DnaC locus|lin1245, protein_id|NP_470582.1, gi|16800314, geneID|1129810
1276 1257362 1257589 228 + 177         FIG00775663: hypothetical protein locus|lin1246, protein_id|NP_470583.1, gi|16800315, geneID|1129811
1277 1257576 1257785 210 + -14         FIG00774865: hypothetical protein locus|lin1247, protein_id|NP_470584.1, gi|16800316, geneID|1129813
1278 1257766 1258203 438 + -20         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) locus|lin1248, protein_id|NP_470585.1, gi|16800317, geneID|1129815
1279 1258225 1258845 621 + 21         FIG00775176: hypothetical protein locus|lin1249, protein_id|NP_470586.1, gi|16800318, geneID|1129816
1280 1258886 1259263 378 + 40         FIG00775670: hypothetical protein locus|lin1250, protein_id|NP_470587.1, gi|16800319, geneID|1129817
1281 1259223 1259399 177 + -41         FIG00774198: hypothetical protein locus|lin1251, protein_id|NP_470588.1, gi|16800320, geneID|1129819
1282 1259411 1259833 423 + 11         FIG00775219: hypothetical protein locus|lin1252, protein_id|NP_470589.1, gi|16800321, geneID|1129820
1283 1259830 1261191 1362 + -4         FIG00776219: hypothetical protein locus|lin1253, protein_id|NP_470590.1, gi|16800322, geneID|1129821
1284 1261204 1261428 225 + 12         hypothetical protein  
1285 1261428 1262372 945 + -1         Phage integrase locus|lin1254, protein_id|NP_470591.1, gi|16800323, geneID|1129822
1286 1262385 1263065 681 + 12         FIG00775669: hypothetical protein locus|lin1255, protein_id|NP_470592.1, gi|16800324, geneID|1129823
1287 1263062 1263355 294 + -4         hypothetical protein locus|lin1256, protein_id|NP_470593.1, gi|16800325, geneID|1129825
1288 1263491 1263643 153 + 135         hypothetical protein  
1289 1264293 1263766 528 - 122         conserved hypothetical protein locus|lin1257, protein_id|NP_470594.1, gi|16800326, geneID|1129826
1290 1264362 1264922 561 + 68         FIG00774160: hypothetical protein locus|lin1258, protein_id|NP_470595.1, gi|16800327, geneID|1129827
1291 1265003 1265425 423 + 80         hypothetical protein locus|lin1259, protein_id|NP_470596.1, gi|16800328, geneID|1129828
1292 1265438 1266205 768 + 12         Phage antirepressor protein locus|lin1260, protein_id|NP_470597.1, gi|16800329, geneID|1129829

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1283 FIG00776219: hypothetical protein
MKREARNYIDNKLKPPKAFFDWCFSQIPTYKWSNKKETILASNRKNCSVIEQKLRKNSRL
TFFGKLNVFGIVLVTSKRIEIQSYAFWNRVVEGKEMIEFDLVNFEQFADGEHVKVAISDG
KMWFGLIPIYGGMSGGPYSMIRLFENDWKEKIRSKSELKYLEIPHLDFKEIETIYKYRVE
IEFLQKIKARQLSKEVMYPVTQYTNGSFRKTVDMRTINAKWLKENKPFFKNSDRGFMEFE
LARRIQKRRGKVVSGIEKYLDYRAINKIPEGVGIVRFQNWIIKNKVDFSYYLDYLNLMRD
LNIAIDSENIIMPKNLVIAHDNAVKLLYQMKHEVEEQQYKMRFEKIKDLEKTIDNYAFIV
PKQASDLLTEGKALSHCVGGSNYIKQHIEGKTTIIFVRDKQYLEKSLYTLEYKNGQIYQL
RGKHNCEPTHDVQEAANNWAASVKSKTKVLQHS

MD5 = c6b1bf65177a7622f7bdbf9e1efb2e09


  DNA Sequence

>fig|272626.9.peg.1283 FIG00776219: hypothetical protein
atgaagagagaagcacgaaattatattgataataaattaaagccaccaaaagcctttttt
gactggtgtttctcacaaattccaacttacaaatggtccaacaaaaaagaaactattcta
gcttccaatcgaaaaaactgcagtgttattgaacagaagttaagaaaaaattctagattg
acattttttggtaaattgaacgtgttcggtattgtcttagttacatcgaaaagaattgag
atacaaagttacgcgttctggaatcgagtagtggaaggaaaagaaatgattgaatttgat
ctagtcaattttgaacaatttgctgatggagaacacgtaaaggttgccatcagcgacggc
aagatgtggtttggtttaattccaatatatggtgggatgtctggaggtccttactcaatg
attcgattgtttgaaaatgactggaaagaaaaaattcgaagtaaatcagagcttaagtac
ctagaaataccgcacttagactttaaagaaattgaaactatatataaatatagagttgaa
attgaatttttgcagaaaattaaagcaagacaattgtccaaggaagttatgtatcccgta
acacaatatacaaatggatcgtttagaaaaacggtagatatgcggacaattaatgcgaag
tggttgaaagaaaacaagcctttctttaagaactcggacagaggttttatggaatttgaa
ttagcaagaagaatacagaaacggcgaggaaaggtagtttctggaattgaaaaatatctt
gattaccgtgctatcaacaaaatcccagaaggagtaggaatagttcgctttcagaattgg
atcattaagaataaagtggattttagctactatctggattatctaaacctaatgcgagac
ttaaatattgcaatcgatagcgaaaacataattatgcctaaaaatttagtaatagctcat
gataacgcggtcaaattactgtaccaaatgaaacatgaagttgaagaacaacaatataaa
atgagatttgagaagataaaagacttagaaaaaacgatagataattacgcttttattgtc
cctaaacaagcttctgatttattaacagaaggcaaagcattaagtcattgtgtgggtggt
agtaattatattaaacaacacattgaagggaaaacaacgattatttttgttcgtgataag
cagtacttagaaaagtcattgtatacacttgaatacaaaaatggccaaatttaccaactg
agaggtaagcacaattgtgagccaacccacgatgtgcaagaggctgcaaacaactgggct
gcatcagtaaaaagtaaaacaaaggtattacaacatagttga


  DNA with Flanking Sequence

>fig|272626.9.peg.1283 FIG00776219: hypothetical protein
agcattaaaaatgacagatacagaagtcgatttgacttttaacgagatgcggatggagtt
agatagttaggaggaaggataatgacaactattggaatgttaagcataaaagagcaagca
ctcaataaaatgttaacggaaatgaatgagaaacactcaggagctgaagatgcagtacat
aattggctctgtactcaagaagaagaagcgatttttgaaggtattctgaaagatgataga
agcattagtggggcggttaaatactgctcctcaagggcttcaaagcatcaggctgaaggc
gtggccatgattgatgacaaaacggtcttttcctgggtgaaaaagtattttatatcagaa
aaagtgccgaaaagtagtgtaaaggctacagttaaaacaactgcaacaaaaccagaaaaa
gcgaaggttaaagctaaggaaaaaccgaaaaaaacaactgcgcaagaagggtatgagcaa
ttagatttgcttgatttcttatgaagagagaagcacgaaattatattgataataaattaa
agccaccaaaagccttttttgactggtgtttctcacaaattccaacttacaaatggtcca
acaaaaaagaaactattctagcttccaatcgaaaaaactgcagtgttattgaacagaagt
taagaaaaaattctagattgacattttttggtaaattgaacgtgttcggtattgtcttag
ttacatcgaaaagaattgagatacaaagttacgcgttctggaatcgagtagtggaaggaa
aagaaatgattgaatttgatctagtcaattttgaacaatttgctgatggagaacacgtaa
aggttgccatcagcgacggcaagatgtggtttggtttaattccaatatatggtgggatgt
ctggaggtccttactcaatgattcgattgtttgaaaatgactggaaagaaaaaattcgaa
gtaaatcagagcttaagtacctagaaataccgcacttagactttaaagaaattgaaacta
tatataaatatagagttgaaattgaatttttgcagaaaattaaagcaagacaattgtcca
aggaagttatgtatcccgtaacacaatatacaaatggatcgtttagaaaaacggtagata
tgcggacaattaatgcgaagtggttgaaagaaaacaagcctttctttaagaactcggaca
gaggttttatggaatttgaattagcaagaagaatacagaaacggcgaggaaaggtagttt
ctggaattgaaaaatatcttgattaccgtgctatcaacaaaatcccagaaggagtaggaa
tagttcgctttcagaattggatcattaagaataaagtggattttagctactatctggatt
atctaaacctaatgcgagacttaaatattgcaatcgatagcgaaaacataattatgccta
aaaatttagtaatagctcatgataacgcggtcaaattactgtaccaaatgaaacatgaag
ttgaagaacaacaatataaaatgagatttgagaagataaaagacttagaaaaaacgatag
ataattacgcttttattgtccctaaacaagcttctgatttattaacagaaggcaaagcat
taagtcattgtgtgggtggtagtaattatattaaacaacacattgaagggaaaacaacga
ttatttttgttcgtgataagcagtacttagaaaagtcattgtatacacttgaatacaaaa
atggccaaatttaccaactgagaggtaagcacaattgtgagccaacccacgatgtgcaag
aggctgcaaacaactgggctgcatcagtaaaaagtaaaacaaaggtattacaacatagtt
gaggaggagtaaatatgaaaccggaattaaatgagttaaaaaaagctaattacagaatta
ggcaagaagctgcggatgaaccgcgaattatccaagtatggtgtccttattgctgggaag
aaaacagatttaattttgaggaactcaaaaaaaactatggtccggaaccacgttggctta
aacataaaaaaataacgtgtcataagtgtgcaactgagatggaatttggtgattgctgat
ggctaagaagaaaaaagaaatactattttgtgattattatgaggactgggttgagactta
caaggtaggagctattgaagacgttacgctaaacaaatattatgtggcagcaagacaact
acgcgatatttgcccaaaattattgatgtctgattttagcaggaaagattatcaattaat
catgaatgaatatggaaaaacacatgaaaagcaaaccgctaaagatttccaccatcacat
aaaagcagctattttagatgct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01LI1302 Listeria innocua CLIP 11262     conserved hypothetical protein
cmr|NT01LI1815 Listeria innocua CLIP 11262     conserved hypothetical protein
emb|CAC96484.1 Listeria innocua EMBL   lin1253
emb|CAC96975.1 Listeria innocua EMBL   lin1744
fig|272626.1.peg.1243 Listeria innocua Clip11262 FIG   FIG00776219: hypothetical protein
fig|272626.1.peg.1733 Listeria innocua Clip11262 FIG   FIG00776219: hypothetical protein
fig|272626.9.peg.1786 Listeria innocua Clip11262 FIG   FIG00776219: hypothetical protein
gi|16413727 Listeria innocua NCBI   lin1253
gi|16414231 Listeria innocua NCBI   lin1744
gi|16800322 Listeria innocua Clip11262 NCBI   hypothetical protein lin1253
gi|16800812 Listeria innocua Clip11262 NCBI   hypothetical protein lin1744
gi|20140646 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized protein Lin1253/Lin1744
img|637223981 Listeria innocua Clip11262 IMG   hypothetical protein
img|637224471 Listeria innocua Clip11262 IMG   hypothetical protein
kegg|lin:lin1253 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
kegg|lin:lin1744 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_470590.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1253
ref|NP_471080.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1744
sp|Q925W4 Listeria innocua SwissProt   RecName: Full=Uncharacterized protein Lin1253/Lin1744
sp|Y1253_LISIN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized protein Lin1253/Lin1744


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search