The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.9.peg.1280: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: FIG00775670: hypothetical protein
Translate Function Assignments



Context on contig NC_003212 from base 1252093 to 1264293 (12201 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1271 1252093 1254033 1941 +           Phage DNA repair ATPase locus|lin1241, protein_id|NP_470578.1, gi|16800310, geneID|1129804
1272 1254037 1254819 783 + 3         Phage recombination protein Bet locus|lin1242, protein_id|NP_470579.1, gi|16800311, geneID|1129806
1273 1254779 1255516 738 + -41     1: 1   Metallo-beta-lactamase superfamily domain protein in prophage locus|lin1243, protein_id|NP_470580.1, gi|16800312, geneID|1129807
1274 1255528 1256445 918 + 11         Phage replication initiation protein locus|lin1244, protein_id|NP_470581.1, gi|16800313, geneID|1129808
1275 1256576 1257184 609 + 130     1: 2   DNA replication protein DnaC locus|lin1245, protein_id|NP_470582.1, gi|16800314, geneID|1129810
1276 1257362 1257589 228 + 177         FIG00775663: hypothetical protein locus|lin1246, protein_id|NP_470583.1, gi|16800315, geneID|1129811
1277 1257576 1257785 210 + -14         FIG00774865: hypothetical protein locus|lin1247, protein_id|NP_470584.1, gi|16800316, geneID|1129813
1278 1257766 1258203 438 + -20         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) locus|lin1248, protein_id|NP_470585.1, gi|16800317, geneID|1129815
1279 1258225 1258845 621 + 21         FIG00775176: hypothetical protein locus|lin1249, protein_id|NP_470586.1, gi|16800318, geneID|1129816
1280 1258886 1259263 378 + 40         FIG00775670: hypothetical protein locus|lin1250, protein_id|NP_470587.1, gi|16800319, geneID|1129817
1281 1259223 1259399 177 + -41         FIG00774198: hypothetical protein locus|lin1251, protein_id|NP_470588.1, gi|16800320, geneID|1129819
1282 1259411 1259833 423 + 11         FIG00775219: hypothetical protein locus|lin1252, protein_id|NP_470589.1, gi|16800321, geneID|1129820
1283 1259830 1261191 1362 + -4         FIG00776219: hypothetical protein locus|lin1253, protein_id|NP_470590.1, gi|16800322, geneID|1129821
1284 1261204 1261428 225 + 12         hypothetical protein  
1285 1261428 1262372 945 + -1         Phage integrase locus|lin1254, protein_id|NP_470591.1, gi|16800323, geneID|1129822
1286 1262385 1263065 681 + 12         FIG00775669: hypothetical protein locus|lin1255, protein_id|NP_470592.1, gi|16800324, geneID|1129823
1287 1263062 1263355 294 + -4         hypothetical protein locus|lin1256, protein_id|NP_470593.1, gi|16800325, geneID|1129825
1288 1263491 1263643 153 + 135         hypothetical protein  
1289 1264293 1263766 528 - 122         conserved hypothetical protein locus|lin1257, protein_id|NP_470594.1, gi|16800326, geneID|1129826

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|272626.9.peg.1280 FIG00775670: hypothetical protein
MPSEELNLFDLMDYYPEQSAKKKRKEEALKPIKTHKNDRLDYPTARAEIERILGKKVTTV
CGYYDHPINKEIRWIFNLEKGCCYINDKCHLYSTEEGKGYKYRGKVHEEVFYNADDRKRA
TTTIE

MD5 = bb84ba32ee675569c12029b296c5d61c


  DNA Sequence

>fig|272626.9.peg.1280 FIG00775670: hypothetical protein
atgccatcagaagaattaaatttattcgatttaatggattactatcctgagcagtctgct
aaaaaaaagcgaaaggaagaagccttaaaaccgattaaaacacataaaaacgatagatta
gattatcctacagcaagagccgaaatagagcggattttaggtaagaaagtaactacagtt
tgcggatattacgatcacccaattaataaagaaattcgatggatattcaatttagaaaaa
ggatgctgctacattaacgataaatgccatttgtattcaacagaagaaggaaaaggatac
aaatatcgcggaaaagtacacgaggaggttttttataatgcagacgatagaaaaagagct
actacaacgattgagtga


  DNA with Flanking Sequence

>fig|272626.9.peg.1280 FIG00775670: hypothetical protein
atcttaccgtgaaaaggttgacccagaaacacgagagccagttcttaaatatatggtcca
taaggatggaactgtggcgatgtactcacaagaaaaacttgatttagaactagaagaatt
acccgcagaagaacgttcaagcgtaattaataaatccgaaattgatgaatatattcttgc
ttgtgaaggaatcgcgatgacaatacctggtgggatttttgaagggaaagaagtacttca
aaaattatcagagggtgaagacatagaggatttggctaggttttatggaactccggttaa
agaaatgcaagacactttagatgaatatcgtaaattcgtagctgccaaagcaaaagcatg
gcaagactggaaaaataactctgaacaaacagctgatagtgaagaacaagaatctgaaaa
tgatggtcaagcaactttagagtttgaaaccgaagaataaaatgctgggcgggaaaccgc
ccttgtaaagaggtgaggaaatgccatcagaagaattaaatttattcgatttaatggatt
actatcctgagcagtctgctaaaaaaaagcgaaaggaagaagccttaaaaccgattaaaa
cacataaaaacgatagattagattatcctacagcaagagccgaaatagagcggattttag
gtaagaaagtaactacagtttgcggatattacgatcacccaattaataaagaaattcgat
ggatattcaatttagaaaaaggatgctgctacattaacgataaatgccatttgtattcaa
cagaagaaggaaaaggatacaaatatcgcggaaaagtacacgaggaggttttttataatg
cagacgatagaaaaagagctactacaacgattgagtgagagaagaataggggttcaacat
cagattgcttcacttgtgcatacagagaagtgcacgttgctagaagcattaaaaatgaca
gatacagaagtcgatttgacttttaacgagatgcggatggagttagatagttaggaggaa
ggataatgacaactattggaatgttaagcataaaagagcaagcactcaataaaatgttaa
cggaaatgaatgagaaacactcaggagctgaagatgcagtacataattggctctgtactc
aagaagaagaagcgatttttgaaggtattctgaaagatgatagaagcattagtggggcgg
ttaaatactgctcctcaagggcttcaaagcatcaggctgaaggcgtggccatgattgatg
acaaaacggtcttttcctgggtgaaaaagtattttatatcagaaaaagtgccgaaaagta
gtgtaaaggctacagttaaaacaactgcaacaaaaccagaaaaagcgaaggttaaagc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01LI1299 Listeria innocua CLIP 11262     hypothetical protein
cmr|NT01LI1818 Listeria innocua CLIP 11262     hypothetical protein
emb|CAC96481.1 Listeria innocua EMBL   lin1250
emb|CAC96978.1 Listeria innocua EMBL   lin1747
fig|272626.1.peg.1240 Listeria innocua Clip11262 FIG   FIG00775670: hypothetical protein
fig|272626.1.peg.1736 Listeria innocua Clip11262 FIG   FIG00775670: hypothetical protein
fig|272626.9.peg.1789 Listeria innocua Clip11262 FIG   FIG00775670: hypothetical protein
gi|16413724 Listeria innocua NCBI   lin1250
gi|16414234 Listeria innocua NCBI   lin1747
gi|16800319 Listeria innocua Clip11262 NCBI   hypothetical protein lin1250
gi|16800815 Listeria innocua Clip11262 NCBI   hypothetical protein lin1747
img|637223978 Listeria innocua Clip11262 IMG   hypothetical protein
img|637224474 Listeria innocua Clip11262 IMG   hypothetical protein
kegg|lin:lin1250 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
kegg|lin:lin1747 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_470587.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1250
ref|NP_471083.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin1747
tr|Q925X6 Listeria innocua TrEMBL   Lin1250 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search