The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|272626.1.peg.79: Listeria innocua Clip11262

This feature in The SEED Viewer

NCBI Taxonomy Id: 272626

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_003212 from base 76030 to 114688 (38659 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
rna.1 76030 76099 70 +       1: 6   tRNA-Lys tRNA-Lys
70 77411 76209 1203 - 109       ff Phage integrase lin0071, NP_469417.1, gi|16799149, CDD:pfam00589, GeneID:1128434
71 78126 77476 651 - 64       ff FIG00775239: hypothetical protein lin0072, NP_469418.1, gi|16799150, GeneID:1128435
72 78981 78505 477 - 378     1: 1 ff
idu(2)
Phage repressor protein cI lin0073, NP_469419.1, gi|16799151, CDD:pfam01381, CDD:smart00530, GeneID:1128436
73 79378 79644 267 + 396     1: 1 ff
isu
Phage A118 gp38 protein homolog lin0074, NP_469420.1, gi|16799152, GeneID:1128437
75 79869 80063 195 + 224       ff FIG00774265: hypothetical protein lin0076, NP_469422.1, gi|16799154, GeneID:1128439
76 80075 80311 237 + 11     1: 1 ff
idu(2)
Phage A118 gp43 protein homolog lin0077, NP_469423.1, gi|16799155, GeneID:1128440
77 80308 80589 282 + -4     1: 1 ff
isu
Phage A118 gp44 protein homolog lin0078, NP_469424.1, gi|16799156, GeneID:1128441
78 81017 80775 243 - 185     1: 1 ff
idu(2)
Hypothetical protein, Lin0079 homolog [Bacteriophage A118] lin0079, NP_469425.1, gi|16799157, GeneID:1128442
79 81081 81854 774 + 63   1: 1 ff
icw(1)
Phage antirepressor protein lin0080, NP_469426.1, gi|16799158, CDD:pfam02498, GeneID:1128443
80 81973 82497 525 + 118     1: 1 ff
idu(2)
Phage A118 gp47 protein homolog lin0081, NP_469427.1, gi|16799159, GeneID:1128444
81 82504 82689 186 + 6     1: 2 ff Phage excisionase lin0082, NP_469428.1, gi|16799160, GeneID:1128446
82 82705 82893 189 + 15     1: 1 ff
idu(2)
Phage A118 gp49 protein homolog lin0083, NP_469429.1, gi|16799161, GeneID:1128447
83 83126 84085 960 + 232     1: 1 ff
icw(1)
Phage exonuclease (EC 3.1.11.3) lin0084, NP_469430.1, gi|16799162, GeneID:1128448
84 84085 84900 816 + -1 5 4: 1 5 3 4 ff
icw(2)
idu(2)
Phage recombination protein Bet lin0085, NP_469431.1, gi|16799163, GeneID:1128450
85 84921 85832 912 + 20     1: 1 ff
idu(2)
Phage replication initiation protein lin0086, NP_469432.1, gi|16799164, GeneID:1128451
86 85829 85996 168 + -4     1: 2   hypothetical protein lin0087, NP_469433.1, gi|16799165, GeneID:1128453
2970 86012 86293 282 + 15       ff FIG00775107: hypothetical protein  
87 86290 87102 813 + -4       ff Phage DNA adenine methylase (EC 2.1.1.72) lin0088, NP_469434.1, gi|16799166, CDD:pfam02086, GeneID:1128454

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Listeria_phi-A118-like_prophages SvetaG Antirepressor [Bacteriophage A118]


  Protein Sequence

>fig|272626.1.peg.79 Phage antirepressor protein
MSNLQIFNFEGNEVRTVFIENEPHFIGKDVAKVLGYSNSRDALKRHVFLKNKGVVKHDSL
GGSQNLTAINEAGLYQLIFKSKLESAERFQDWVTSEVLPSVRKHGAYMTNDTIEKAITDP
DFLIKLATNLKEEKTKRIEAEQRLEIQKPKVMFAEAVSDARGTILIRDLAKLIQQNGIDI
GEKRLFEWMRQRGYLISRKGTDYNRPTQKSMELGLFKIKETAIIRSSGAQTAITAKVTGK
GQLYFVNKFLEQSLKTI

MD5 = bb4377f3888cd5d0705e319b3a3c684b


  DNA Sequence

>fig|272626.1.peg.79 Phage antirepressor protein
atgtcaaatttacaaatcttcaactttgaaggaaatgaagtaagaacagtatttattgaa
aacgagcctcattttatcggcaaagacgtggcaaaagtattgggatattcaaatagccgc
gatgcattaaaacgccatgttttccttaaaaacaagggggtcgtgaaacacgactccctt
ggaggaagccaaaatttaaccgctataaatgaagcgggtctatatcagttgatttttaaa
tcaaaactagaatctgctgaaagatttcaagactgggttacttcggaagtattgccatct
gtccgtaagcatggtgcttacatgacaaatgacacaatagaaaaagcaatcactgaccct
gattttctaatcaaactagcaacaaatttaaaagaagaaaaaacgaagcggatagaagcg
gaacaaaggttagaaatacaaaagccgaaagtgatgtttgctgaagctgtaagcgatgca
agaggaaccattttaataagagatttagctaagctaatccaacaaaacggcatcgatatt
ggggagaaaagactatttgaatggatgcgccaaagaggatatctcatttcgagaaaaggc
acggattacaatcgccctacgcaaaaaagtatggaactgggactgtttaagattaaagaa
acagcgattataagatcaagcggagcgcaaacagcaattacagcaaaagttacaggcaaa
ggacaactttactttgtaaataagttcttagaacaatcattaaaaacaatttaa


  DNA with Flanking Sequence

>fig|272626.1.peg.79 Phage antirepressor protein
gtgaagtgaagcttttccaaaaagaataggaggttaaaaaatgaaggactttgaaatgat
ggaagcaattaaacaaaaacggcttgaatgtaaattagtaattttggaaaattttgaatc
gagttttaaagaagccctcaataagggagattccgccatggtgtcggctttagcggaatc
attgaaaacagttattaaatagtgaactcaatgtaaaggacatcatttgagttcattaga
aaaactttcgataaatcgttttctaactcgcttgcacccttataaatgattttgtaagtt
ttatcggcttctaaataaaaatcatttaaatcaaaacttttgttatctggaaaagatgta
atgcttataacgcccattagagcaatgggctggtcatcagagatacctttgaacattata
tccatgcgatttttcacaaattccacctcccttcacaaaaactatagcactgtgaaaggg
cgaacagaaaggagaacaaaatgtcaaatttacaaatcttcaactttgaaggaaatgaag
taagaacagtatttattgaaaacgagcctcattttatcggcaaagacgtggcaaaagtat
tgggatattcaaatagccgcgatgcattaaaacgccatgttttccttaaaaacaaggggg
tcgtgaaacacgactcccttggaggaagccaaaatttaaccgctataaatgaagcgggtc
tatatcagttgatttttaaatcaaaactagaatctgctgaaagatttcaagactgggtta
cttcggaagtattgccatctgtccgtaagcatggtgcttacatgacaaatgacacaatag
aaaaagcaatcactgaccctgattttctaatcaaactagcaacaaatttaaaagaagaaa
aaacgaagcggatagaagcggaacaaaggttagaaatacaaaagccgaaagtgatgtttg
ctgaagctgtaagcgatgcaagaggaaccattttaataagagatttagctaagctaatcc
aacaaaacggcatcgatattggggagaaaagactatttgaatggatgcgccaaagaggat
atctcatttcgagaaaaggcacggattacaatcgccctacgcaaaaaagtatggaactgg
gactgtttaagattaaagaaacagcgattataagatcaagcggagcgcaaacagcaatta
cagcaaaagttacaggcaaaggacaactttactttgtaaataagttcttagaacaatcat
taaaaacaatttaagcgccgctaccacaacggcgctcgcagacaacttagtcacggggag
cgactaacaatagtatataacgataagttgttaattagtggttaaaaaataaacaaaaag
gattgagatattatgtttcaaaaatcaacatcagcgccaaccgcgatgcaagttttagca
gaaactcgcacgcaaaaagagctagcgattgatagttatgtaacaccagcactaataagc
aaccagttgaaaggaaagcgtacagtttcacttgaacaagcagaacagttaattgatagc
tacaacgaaccagaaagcacatatttattcgcacatgaattttcaaacggaatgatacct
ccacttttcgacggcttagacagtcaccatgcggctttaacttgtcgctttgaactagaa
gtaacagaagcagtaaatgcgttaaaaagcggattagaaacgatgacattcaatttaaga
aaaggcgacatgctacaacgagaagccgcaaaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT01LI0085 Listeria innocua CLIP 11262     bacteriophage L54a, antirepressor, putative
emb|CAC95313.1 Listeria innocua EMBL   lin0080
fig|272626.9.peg.87 Listeria innocua Clip11262 FIG   Phage antirepressor protein
fig|393126.4.peg.2731 Listeria monocytogenes FSL R2-561 FIG   Phage antirepressor protein
gi|16412500 Listeria innocua NCBI   lin0080
gi|16799158 Listeria innocua Clip11262 NCBI   hypothetical protein lin0080
gi|224503549 Listeria monocytogenes FSL R2-561 NCBI   hypothetical protein LmonFR_13752
img|637222796 Listeria innocua Clip11262 IMG   hypothetical protein
kegg|lin:lin0080 Listeria innocua CLIP 11262 (serotype 6a) KEGG   hypothetical protein
ref|NP_469426.1 Listeria innocua Clip11262 RefSeq   hypothetical protein lin0080
ref|ZP_03671856.1 Listeria monocytogenes FSL R2-561 RefSeq   hypothetical protein LmonFR_13752
tr|Q92FM4 Listeria innocua TrEMBL   Lin0080 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|272626.1.peg.84 Phage recombination protein Bet


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33416 961.500;1-137
CDD::33443 969.600;126-256
CDD::43300 964.600;126-252
CELLO::cytoplasm 3.359
evidence_code ff
evidence_code icw(1);Listeria_phi-A118-like_prophages
in_phage List-I1
IPR::IPR003497_interpro_download 106.3;13-99
IPR::IPR005039_interpro_download 220.1;120-255
isoelectric_point 10.23
molecular_weight 29228
PFAM::PF02498 971.900;13-99
PFAM::PF02498_interpro_download 106.3;13-99
PFAM::PF03374 937.480;120-255
PFAM::PF03374_interpro_download 220.1;120-255
PSORT::Cytoplasmic 8.87
PSORT_score::Cytoplasmic 8.87
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   Listeria innocua CLIP 11262 -Institut Pasteur  |   RNAFold  |

> Show tool descriptions


FIG search