The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|264731.4.peg.1914: Prevotella ruminicola 23

This feature in The SEED Viewer

NCBI Taxonomy Id: 264731

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_014033 from base 2365843 to 2378166 (12324 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1908 2368116 2365843 2274 -       1: 1   hypothetical protein locus|PRU_1962, protein_id|YP_003575241.1, gi|294674625, geneID|9002411
1909 2368938 2368315 624 - 198         Phage antirepressor protein locus|PRU_1963, protein_id|YP_003575242.1, gi|294674626, geneID|9000590
1910 2369953 2369477 477 - 538     1: 1   hypothetical protein  
1911 2370810 2370175 636 - 221     1: 1   hypothetical protein locus|PRU_1965, protein_id|YP_003575243.1, gi|294674627, geneID|9000565
1912 2371145 2371273 129 + 334     1: 1   hypothetical protein  
1913 2371263 2371604 342 + -11         RelE-like translational repressor toxin  
1914 2372205 2372366 162 + 600   1: 1   hypothetical protein locus|PRU_1967, protein_id|YP_003575244.1, gi|294674628, geneID|9002082
1915 2372359 2373303 945 + -8 4 1: 3   Protein kinase domain of HipA locus|PRU_1968, protein_id|YP_003575245.1, gi|294674629, geneID|9002150
1916 2374945 2373536 1410 - 232         Putative surface protein locus|PRU_1969, protein_id|YP_003575246.1, gi|294674630, geneID|9000168
1917 2375583 2376134 552 + 637     1: 1   DNA-binding protein, histone-like family locus|PRU_1970, protein_id|YP_003575247.1, gi|294674631, geneID|9000553
1918 2376378 2376256 123 - 121     1: 1   hypothetical protein  
1919 2376532 2378166 1635 + 153     8: 6 8 4 10 5 2 7 9   CTP synthase (EC 6.3.4.2) gene_name|pyrG, locus|PRU_1972, protein_id|YP_003575248.1, gi|294674632, geneID|9001340

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|264731.4.peg.1914 hypothetical protein
MMFPVFDGLIPEGWLLDIASSSWKINPRDRMSLLMACCKDCIGNISVKPMSHE

MD5 = da5c9f12eb97201ca7f647f8f384f0c8


  DNA Sequence

>fig|264731.4.peg.1914 hypothetical protein
atgatgttccctgttttcgacggactcatacctgagggatggctgctggatattgcctct
tcgtcgtggaagattaatccacgcgacaggatgtcgctcttaatggcatgttgcaaggat
tgtattggaaacatcagtgtaaaaccaatgagccatgagtaa


  DNA with Flanking Sequence

>fig|264731.4.peg.1914 hypothetical protein
ttttgcgatgcgataactctgcgaaagggatttttatatctgttcgggtataattttgtt
ataattacttaaaattatacccgtattgatataatcaaacgatttaatacttatctttgt
acccgttaaggtataatgataatgactttatcggagtatattaagcaaaaaaggaaagaa
aacggcctttctcaggttgaattagcagagagggccggagtaggtctcaggtttgtgaga
gacttggaacaggggaagcagaccttgcgaatggacaaggttaacgacgtgctggccctg
tttggcgaatgtctcggaccagtaaaaactaacgttgtatgaaacaggcaggtatttttg
taaacgacgtcttttgtggtatattgacagaggacgaagaagggtttcattttgcttacg
acaaatcgtatcttgaacgtaaggatgcagccccagtaagtcccactatgcctcttacgc
aacggcaatacgacaaggaaatgatgttccctgttttcgacggactcatacctgagggat
ggctgctggatattgcctcttcgtcgtggaagattaatccacgcgacaggatgtcgctct
taatggcatgttgcaaggattgtattggaaacatcagtgtaaaaccaatgagccatgagt
aagtgcctgttttgttataaagaactggaagaaggccagattgacgttcatcctgcatgc
gccagaaagtttttcggcagtactgatgtgcccatcattccttatactcgtgataacatg
tcggaactggcccgacaggttattcgtaccagtgcatctgttacgggtgtgcaggcaaaa
atgtcgctcgacgtgaatcgtggcagcagaaaagaaccggccaagttcaccattgtcgga
ctttggggtaagtatatcttcaagccgcaaagcgggcattatccctgtctgcctgaatta
gaagacctgacgatgaagatggccgaagctgcccgtatccgtacagcccgacatacactg
atccgactggctgatggcgaactgggctatctgacgctccgtatggaccgtgggcggaaa
ggcgagaagatttcgatgcttgatatgtgccaacttaccaaccggcttacagaacataag
tattacggcacctaccagcaat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|264731.4.peg.1915 Protein kinase domain of HipA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search