The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|264731.4.peg.1909: Prevotella ruminicola 23

This feature in The SEED Viewer

NCBI Taxonomy Id: 264731

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_014033 from base 2360796 to 2374945 (14150 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1906 2365289 2360796 4494 -       4: 3 2 6 5   Glutamate synthase [NADPH] large chain (EC 1.4.1.13) gene_name|gltA_2, locus|PRU_1960, protein_id|YP_003575239.1, gi|294674623, geneID|9001491
1907 2365780 2365445 336 - 155     1: 1   hypothetical protein locus|PRU_1961, protein_id|YP_003575240.1, gi|294674624, geneID|9000232
1908 2368116 2365843 2274 - 62     1: 1   hypothetical protein locus|PRU_1962, protein_id|YP_003575241.1, gi|294674625, geneID|9002411
1909 2368938 2368315 624 - 198         Phage antirepressor protein locus|PRU_1963, protein_id|YP_003575242.1, gi|294674626, geneID|9000590
1910 2369953 2369477 477 - 538     1: 1   hypothetical protein  
1911 2370810 2370175 636 - 221     1: 1   hypothetical protein locus|PRU_1965, protein_id|YP_003575243.1, gi|294674627, geneID|9000565
1912 2371145 2371273 129 + 334     1: 1   hypothetical protein  
1913 2371263 2371604 342 + -11         RelE-like translational repressor toxin  
1914 2372205 2372366 162 + 600     1: 1   hypothetical protein locus|PRU_1967, protein_id|YP_003575244.1, gi|294674628, geneID|9002082
1915 2372359 2373303 945 + -8     1: 4   Protein kinase domain of HipA locus|PRU_1968, protein_id|YP_003575245.1, gi|294674629, geneID|9002150
1916 2374945 2373536 1410 - 232         Putative surface protein locus|PRU_1969, protein_id|YP_003575246.1, gi|294674630, geneID|9000168

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|264731.4.peg.1909 Phage antirepressor protein
MFVAKDVATALGYTNTPKAIRDHIDDDDKLTERFVLSGQVRSVIIINESGLYALILSSKL
PQAKAFKHWVTSEVLPQIRQTGGYIPTRAADGRDLSAVEILHRADAIVGNTLRMLNEPAE
DTLTATQVAKTFNMTTYDFNAILRDMGIQYRRDGHWNISDDLADRNLTRLRTHVSYSLKG
QKKVKVYMTWTLDGVRFLNSKLGYPNF

MD5 = cca3f1434f56a50f0a91ecdddbe42b94


  DNA Sequence

>fig|264731.4.peg.1909 Phage antirepressor protein
atgtttgtggctaaggatgttgccacagcattggggtatactaataccccgaaagctatt
cgcgaccatattgacgacgacgataagctgaccgaacgattcgttctgtcaggtcaagtt
cgaagtgtcatcatcatcaacgagagcggactttacgcactcatcctctcatccaagctt
ccacaagccaaggcctttaagcactgggttaccagcgaggtgctgccacagattcgccag
acgggcggttacattccaacccgcgctgctgatggccgcgacctttctgccgttgaaatc
ctgcaccgagccgatgcgattgttggtaacaccttgcgcatgctgaacgagcccgccgag
gatacactgacggctacgcaggtggccaagacgtttaacatgactacctacgactttaac
gccattctgcgcgacatgggcatacagtaccgccgcgatgggcattggaacatcagcgac
gatctggccgaccgcaaccttacacgcctgcgcacgcacgtatcctatagtttaaagggc
cagaagaaagtaaaggtttatatgacctggacccttgatggcgtgagattccttaattct
aaacttggttatcctaatttctaa


  DNA with Flanking Sequence

>fig|264731.4.peg.1909 Phage antirepressor protein
gaattttttttcgattttttttgagattcgcagaaaacctttatagcaaggatttctgcg
tttttttttatgtgctatacccaactttttcgctcagcgttatttcttttttccaattaa
cgctgactccccaaacattattactatagaagcacctctggcgagaggcacatacttcga
aagcgttctttgacatgttgatacttcgaaacgcacgggtaggcccgagcgtacacagca
catatgcatacacatgcgtaccttagttattctaatccatgactgatgcacaacaacaaa
cattaataacaatttatccccgctgaaaaggcagcgggatgctgagtgaagtgagcagaa
ggaatctcatgagacaagctggccagcgtttcagatgcctcttccctcgctaaactcaca
acaaaatgaaaacagcaatacagatttttactagtgaaattttcggcgagattcgtactt
gccaggttaataatcaaatcatgtttgtggctaaggatgttgccacagcattggggtata
ctaataccccgaaagctattcgcgaccatattgacgacgacgataagctgaccgaacgat
tcgttctgtcaggtcaagttcgaagtgtcatcatcatcaacgagagcggactttacgcac
tcatcctctcatccaagcttccacaagccaaggcctttaagcactgggttaccagcgagg
tgctgccacagattcgccagacgggcggttacattccaacccgcgctgctgatggccgcg
acctttctgccgttgaaatcctgcaccgagccgatgcgattgttggtaacaccttgcgca
tgctgaacgagcccgccgaggatacactgacggctacgcaggtggccaagacgtttaaca
tgactacctacgactttaacgccattctgcgcgacatgggcatacagtaccgccgcgatg
ggcattggaacatcagcgacgatctggccgaccgcaaccttacacgcctgcgcacgcacg
tatcctatagtttaaagggccagaagaaagtaaaggtttatatgacctggacccttgatg
gcgtgagattccttaattctaaacttggttatcctaatttctaataaatatatttagcaa
cggactacaggactgacaagattgattagaaaaatcgtaaagtcctgttatccgttgcaa
aaaaatgaaaaactatgagtgtacatgtaatttatataaaggatggggcgaagatgatgc
gtcccgtcctaacgagagaggagtatttgagtttgcgaaatggtggcgagcaacagcaat
tggtgcagcggatacgcgcaggtgaggaggctttgaaacacaagctgctgcagatgaact
acagctgtctgcctaacgatgatggcagcctaaagggcagcacccgaatgagcaccaccg
ttggcatggatatcgaccacctgacacccgatgagatgcccgccgtacgtgagcgcatct
tagctaagaaagatgagctgggattgaagatgatggaggagagtgcccgtggtggtggct
accatctggtgtttgcgcgaaagcccgaactgagtcaggaggagaacctgaaatgggcga
gcga


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search