The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|264731.4.peg.1906: Prevotella ruminicola 23

This feature in The SEED Viewer

NCBI Taxonomy Id: 264731

Current Assignment: Glutamate synthase [NADPH] large chain (EC 1.4.1.13)
Translate Function Assignments



Context on contig NC_014033 from base 2356057 to 2370810 (14754 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1903 2358270 2356057 2214 -       7: 3 12 14 11 2 5 4   Glutamine synthetase type III, GlnN (EC 6.3.1.2) gene_name|glnA_2, locus|PRU_1957, protein_id|YP_003575236.1, gi|294674620, geneID|9002338
1904 2359270 2358467 804 - 196     6: 13 9 6 15 7 8   Diaminopimelate epimerase (EC 5.1.1.7) gene_name|dapF, locus|PRU_1958, protein_id|YP_003575237.1, gi|294674621, geneID|9000900
1905 2360704 2359295 1410 - 24 19 5: 3 10 2 5 4   Glutamate synthase [NADPH] small chain (EC 1.4.1.13) gene_name|gltD, locus|PRU_1959, protein_id|YP_003575238.1, gi|294674622, geneID|9000283
1906 2365289 2360796 4494 - 91   4: 3 2 5 4   Glutamate synthase [NADPH] large chain (EC 1.4.1.13) gene_name|gltA_2, locus|PRU_1960, protein_id|YP_003575239.1, gi|294674623, geneID|9001491
1907 2365780 2365445 336 - 155     1: 1   hypothetical protein locus|PRU_1961, protein_id|YP_003575240.1, gi|294674624, geneID|9000232
1908 2368116 2365843 2274 - 62     1: 1   hypothetical protein locus|PRU_1962, protein_id|YP_003575241.1, gi|294674625, geneID|9002411
1909 2368938 2368315 624 - 198         Phage antirepressor protein locus|PRU_1963, protein_id|YP_003575242.1, gi|294674626, geneID|9000590
1910 2369953 2369477 477 - 538     1: 1   hypothetical protein  
1911 2370810 2370175 636 - 221     1: 1   hypothetical protein locus|PRU_1965, protein_id|YP_003575243.1, gi|294674627, geneID|9000565

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ammonia_assimilation OlgaZ Glutamate synthase [NADPH] large chain (EC 1.4.1.13)
Glutamine,_Glutamate,_Aspartate_and_Asparagine_Biosynthesis OlgaZ Glutamate synthase [NADPH] large chain (EC 1.4.1.13)
_Glutamate,_Glutamine,_Aspartate,_and_Asparagine_biosynthesis_HGM_New Kutt_Laura_user Glutamate synthase [NADPH] large chain (EC 1.4.1.13)
Glutamate,_Glutamine,_Aspartate,_and_Asparagine_biosynthesis_PanGenomes Acharya_Geeta_user Glutamate synthase [NADPH] large chain (EC 1.4.1.13)


  Protein Sequence

>fig|264731.4.peg.1906 Glutamate synthase [NADPH] large chain (EC 1.4.1.13)
MTKRKQTQPKKGLYQSDYEHDACGVGMVVNIHGGKSHDLVDNALKVLENMEHRGAETRDK
TGDGAGIMVQIPHEFILLQGIPVPEKGKYGTGLVFLPKDEKAQQQILSVMIEEIEREGLQ
LMHLRTVPTNPEVLGVAAREVEPDIKQIFVTGVSEDNVPVFERILYKVRKRIENRIDDED
FYLCSLSSKNIIYKGMLTSGQLRRYFPDLSNDYFTSGLALVHSRFSTNTFPKWKLAQPFR
LLAHNGEINTIRGNRGWMKARESVLSSEALGDIKDLRPIVQDGMSDSASLDNVFEFLMMS
GLSLPQAMAILVPESFNDKNPISEDLKAFYEYHSILMEPWDGPAALLFSDGRYAGGMLDR
NGLRPSRYTITKQGMMVVASEVGVMDFEPGDVVSKGRLQPGKILLIDTQEGKIYYDGEIK
EKLAKAHPYREWLAENRVQLEKLKSGRKVDNGVSDLQQKLVTFGFGQEDIDKTIIPMATA
GQEPVAAMGNDTPLAVISDRPQVLFNYFRQQFAQVTNPAIDPIREELVMSLTEYIGAVGT
NILTPDASNCKMVRLPQPVLTNTQLDILCNIRYKGFNTKKLPIVFEMAKGEEGLRQALDD
LCHQAEASVDEGVNYIILSDRDLDDTHAAIPSLLAVSAVHHYLISVGKRVQTALIVESGE
IREVMHAALLLGYGASALCPYMTFAVLDDLVKHHKIQEEYATAEKNYIKAVDKGLKKIMS
KMGISTIRSYRGAKIFESIGLSEDLLRRYFGTEVSTIGGVGLKEIARDAIALHEAAKEQT
LLQNQGQFAWRKDGIKHAWNPETIAKLQLATRQGNYEKFKQWSKLVDEKESPIFIRDFFG
FKKAAKPTPIDEVESVESIVKHFVTGAMSFGALSIEAHEALALAMNKLGARSNTGEGGED
NARYHSEVDGVSLSSKTKQIASGRFGVTAEYLVNAEEIQIKVAQGAKPGEGGQLPGFKVN
EIIAKTRNAIPGISLISPPPHHDIYSIEDLAQLIFDLKNINPTAAVSVKLVAESGVGTIA
AGVAKAKADLIVISGAEGGTGASPASSMRFAGISPEIGLAETQQTLVMNGLRNQVRLQTD
GQLKTAKDVIIMAMLGADEFSFGTLPLIVLGCVMMRKCNTNTCPMGVATQNPELRKHFEG
RAEYVVNFFTFLAEQVREYLSEIGVKSLKEIIGHTELIEVNTENATDKQKTIDFARLLHK
PATDKALYWDRGAYTKVTGVKDEEMIKAAQKAIENQEEVTLDYAIKNTDRAVGTMLSGVI
AQKYGEEGLPDGTIKIKFKGSAGQSFGAFAVKGLDLRLEGETNDYFGKGLSGGRISILPP
ARRSDDFKAEENIIAGNTGLYGATSGELYINGKVGERFGVRNSGAIAVIEGAGDHCCEYM
TGGRVVVLGKTGRNFAAGMSGGVAYVYDPDHTFDYFCNMDMVELSLVEDSVSRKELLELI
REHYLHTGSALAGRMLDDWHRYIEDFIQVVPIEYKRVLEEEKMARLHEKIADIQRDY

MD5 = c0233dfc0209d30b5fbe44ad186d9227


  DNA Sequence

>fig|264731.4.peg.1906 Glutamate synthase [NADPH] large chain (EC 1.4.1.13)
atgacaaaaagaaagcaaactcaacccaaaaaaggactctaccaatctgactatgagcat
gatgcttgcggcgtgggtatggtggttaacatacacggcggaaaaagtcatgatctggtt
gacaatgcactgaaggtgcttgagaacatggaacaccgtggcgccgagacacgcgacaag
accggtgatggtgcgggtatcatggtacagataccccacgagtttattttgttacagggt
atccccgtgcccgaaaagggtaagtacggcactggtctggtttttctgcctaaggacgag
aaggcccagcagcagattctgagcgtgatgattgaggagattgagcgcgagggcctgcag
ctgatgcacctgcgtacggtgcccaccaaccccgaggtgctgggtgtggctgcccgcgag
gtggaacccgacattaagcagatatttgtaacgggcgtgtcggaggataacgtgcccgtg
tttgagcgtatattatataaggtacgcaagcgcattgagaaccgcattgatgatgaggac
ttctacttgtgctcgctatcaagcaagaatattatctacaaggggatgcttaccagcgga
cagctgcgtcgctatttccctgatctttcgaacgattactttacgagcggactggccttg
gttcactcgcgtttctcgactaatacattcccaaaatggaagctggcacagcctttccgt
ctgctggcccacaacggtgagattaacaccattcgtggtaaccgcggctggatgaaggca
agagagagtgtgctgagcagcgaggcgctgggcgatatcaaggacttgcgcccgattgtg
caggacggcatgagcgactcggccagcttggacaacgtattcgagttcctgatgatgagc
ggactctcgttgccacaggccatggccatcctggtgcccgagagctttaacgataagaac
cctatttcagaagatttgaaagccttctacgaatatcactctatcctgatggagccgtgg
gacggtcctgccgcactgctgtttagcgatggtcgctacgcaggcggtatgctggaccgc
aacggactgcgccccagccgctacaccatcaccaagcaaggtatgatggtggtagcctct
gaggttggcgtgatggactttgagcccggcgacgtggtttcgaagggacgcctgcagcca
ggaaagattctgctgattgatacgcaggaaggcaagatttactacgatggcgagattaag
gagaagctggccaaggcgcatccttaccgcgagtggctggccgagaaccgcgtgcagctt
gagaaactgaagagcggacgtaaggtggataacggtgtgagcgacttgcagcagaagctg
gttaccttcggattcggtcaggaggatatcgacaagacgattatccctatggccacagcc
ggacaggagcctgtagctgccatgggtaacgacacaccgctggccgttatcagcgaccgt
ccacaggtgctgttcaactacttccgtcagcagtttgcacaggttaccaaccctgccatc
gaccctatccgcgaggaactggtgatgagtctaaccgagtatatcggcgctgtaggcacc
aacattctgacacccgacgcatctaactgtaagatggtgcgcctgccgcaaccagtttta
accaacacacaacttgatatactttgtaacatccgctacaagggcttcaacaccaagaag
ttgcctatcgtgtttgagatggccaagggtgaggaaggcttgcgccaggctctggacgac
ctgtgccaccaggccgaagccagtgtagatgagggtgtgaactacattatcctgagcgac
cgcgacctggacgatacccatgccgccatcccatcgctgttggccgttagtgctgttcac
cactacctgattagcgtaggtaagcgtgtgcagacagctctgattgttgagagcggtgag
attcgcgaggtaatgcacgcagccctgctgctgggttacggagccagcgccctgtgccca
tacatgacgtttgcggtactcgacgatctggtgaagcaccacaagattcaggaggagtac
gccaccgccgagaagaactacatcaaggccgtggacaagggtctgaagaagattatgagt
aagatgggtatcagcaccatccgcagctaccgcggtgccaagatctttgagagcatcgga
ctgagcgaggatctgctgcgccgctacttcggtaccgaggtgagcaccattggtggtgta
ggcctgaaggagatagcccgtgatgccattgcgctgcacgaggctgccaaggagcagaca
ctgctgcagaaccagggccagtttgcatggcgtaaggatggtattaagcacgcctggaac
cccgagaccatcgctaagctgcagttggctacccgtcagggtaactacgaaaagttcaag
cagtggtcgaagctggtggatgagaaggagagccccatctttatccgcgacttcttcgga
ttcaagaaggctgctaagccaaccccaatcgacgaggttgagagcgtagaaagcattgtt
aagcattttgttacaggtgctatgagtttcggtgccctgagcatcgaggcccacgaggca
ctggcactggccatgaacaagctgggcgcccgcagtaacaccggtgagggtggtgaggac
aacgcccgctaccactcggaggttgacggtgtaagcttgagctcgaagaccaagcagatt
gccagtggacgtttcggtgtaaccgccgagtacctggtgaatgccgaggagatacagatt
aaggtggcacaaggagcaaaacctggtgagggcggacagctgcctggctttaaggttaac
gagattatcgccaagacacgtaacgccatccccggtatctcgctcatctcgcctccacca
catcacgatatctacagtatcgaggacctggcacagcttatcttcgacctgaagaatatc
aaccccacagctgccgtcagcgtaaaactggtggccgagagcggtgtaggaaccattgcc
gctggtgtggcaaaggccaaggccgatctgattgttatcagtggtgccgagggtggtaca
ggtgccagccctgcttcaagtatgcgatttgcaggtattagtcctgagatcggactggcc
gagacccagcagacactggtgatgaacggcctgcgtaaccaggttcgcctgcagaccgac
ggacagctgaagactgccaaggacgtgataatcatggctatgcttggtgccgacgagttc
tcgttcggaacactgcccctgattgttctgggctgtgtgatgatgcgtaagtgtaatacc
aatacctgccccatgggtgtggctacccagaaccccgagctgcgtaagcattttgagggt
agagccgagtacgtggttaacttctttaccttcctggccgagcaggtgcgcgaatacctg
agtgaaatcggcgtgaagagtctgaaggagattatcggacacaccgaactgattgaggtg
aacaccgagaacgctaccgacaagcagaagaccatcgactttgcacgcttgctgcacaag
cctgcaaccgacaaggctctgtactgggatcgcggtgcctacaccaaggtgacaggcgtg
aaggacgaggagatgattaaggctgcacagaaggccatcgagaaccaggaagaggtaaca
ctcgactatgccatcaagaataccgaccgtgccgtgggtaccatgctgagtggtgtgatt
gcccagaagtacggcgaggaaggactgcccgacggaactatcaaaattaagttcaagggc
tcggctggtcagagtttcggtgcctttgccgtgaagggactggatttgcgcctcgagggt
gagaccaacgactactttggtaagggcctttcgggtggtcgcatctctattctgcctcca
gctcgccgcagcgacgactttaaggctgaagaaaatattatcgcaggtaacaccggactt
tacggtgctacatcgggcgaactctatataaatggtaaggtaggcgagcgcttcggagtg
cgtaactcgggtgccatcgctgtgattgaaggtgccggcgaccactgctgcgagtacatg
actggcggacgtgtggtagtgctgggtaagacaggccgaaactttgctgccggtatgagt
ggtggcgtggcctatgtttacgaccccgatcacacattcgactacttctgcaacatggat
atggttgaactctcgctggttgaggacagcgtatcgcgcaaagaactgttggagctgatt
cgtgagcactatctgcacacaggctcggccctggcaggacgtatgctcgacgactggcac
cgctacatcgaggactttatccaggttgtgcctatcgagtacaaacgcgtgctcgaagaa
gagaagatggcgcgcctgcacgagaagattgccgacatccagcgcgactattag


  DNA with Flanking Sequence

>fig|264731.4.peg.1906 Glutamate synthase [NADPH] large chain (EC 1.4.1.13)
gaatgttttgtgcagctctggcgcaagctggagcgcacaaggcgcctgctgggcgggcag
tgcaagcgcttctgcatacgtaacgtgctgaaagcatggttcggtgctgcggccaacgat
gatatgatatggcacgtgtgccatctgtgcgagcaggagggctggaacgagctgcctctg
cccaatctctatccgcgcaagcatcgcgagctgctgcgtgccatcgtggccgtaagcacc
ggcatcagcttctggcgcatcgatctgaaggcgctcgacagtgcctatagcgtagccttt
ccgcatagcacaccgttaaatgttaataagaaaaagaaaaattagtttcaatctgtaagc
atttcaatgcgatttgcttacagattgttattttcgacaaaaatgtagataaaaacgtca
gcgtttcggcttgtttgatagcaaaacgttatacctttgcggtcgaaatcggacaaaatg
taagattaacaaaggataatatgacaaaaagaaagcaaactcaacccaaaaaaggactct
accaatctgactatgagcatgatgcttgcggcgtgggtatggtggttaacatacacggcg
gaaaaagtcatgatctggttgacaatgcactgaaggtgcttgagaacatggaacaccgtg
gcgccgagacacgcgacaagaccggtgatggtgcgggtatcatggtacagataccccacg
agtttattttgttacagggtatccccgtgcccgaaaagggtaagtacggcactggtctgg
tttttctgcctaaggacgagaaggcccagcagcagattctgagcgtgatgattgaggaga
ttgagcgcgagggcctgcagctgatgcacctgcgtacggtgcccaccaaccccgaggtgc
tgggtgtggctgcccgcgaggtggaacccgacattaagcagatatttgtaacgggcgtgt
cggaggataacgtgcccgtgtttgagcgtatattatataaggtacgcaagcgcattgaga
accgcattgatgatgaggacttctacttgtgctcgctatcaagcaagaatattatctaca
aggggatgcttaccagcggacagctgcgtcgctatttccctgatctttcgaacgattact
ttacgagcggactggccttggttcactcgcgtttctcgactaatacattcccaaaatgga
agctggcacagcctttccgtctgctggcccacaacggtgagattaacaccattcgtggta
accgcggctggatgaaggcaagagagagtgtgctgagcagcgaggcgctgggcgatatca
aggacttgcgcccgattgtgcaggacggcatgagcgactcggccagcttggacaacgtat
tcgagttcctgatgatgagcggactctcgttgccacaggccatggccatcctggtgcccg
agagctttaacgataagaaccctatttcagaagatttgaaagccttctacgaatatcact
ctatcctgatggagccgtgggacggtcctgccgcactgctgtttagcgatggtcgctacg
caggcggtatgctggaccgcaacggactgcgccccagccgctacaccatcaccaagcaag
gtatgatggtggtagcctctgaggttggcgtgatggactttgagcccggcgacgtggttt
cgaagggacgcctgcagccaggaaagattctgctgattgatacgcaggaaggcaagattt
actacgatggcgagattaaggagaagctggccaaggcgcatccttaccgcgagtggctgg
ccgagaaccgcgtgcagcttgagaaactgaagagcggacgtaaggtggataacggtgtga
gcgacttgcagcagaagctggttaccttcggattcggtcaggaggatatcgacaagacga
ttatccctatggccacagccggacaggagcctgtagctgccatgggtaacgacacaccgc
tggccgttatcagcgaccgtccacaggtgctgttcaactacttccgtcagcagtttgcac
aggttaccaaccctgccatcgaccctatccgcgaggaactggtgatgagtctaaccgagt
atatcggcgctgtaggcaccaacattctgacacccgacgcatctaactgtaagatggtgc
gcctgccgcaaccagttttaaccaacacacaacttgatatactttgtaacatccgctaca
agggcttcaacaccaagaagttgcctatcgtgtttgagatggccaagggtgaggaaggct
tgcgccaggctctggacgacctgtgccaccaggccgaagccagtgtagatgagggtgtga
actacattatcctgagcgaccgcgacctggacgatacccatgccgccatcccatcgctgt
tggccgttagtgctgttcaccactacctgattagcgtaggtaagcgtgtgcagacagctc
tgattgttgagagcggtgagattcgcgaggtaatgcacgcagccctgctgctgggttacg
gagccagcgccctgtgcccatacatgacgtttgcggtactcgacgatctggtgaagcacc
acaagattcaggaggagtacgccaccgccgagaagaactacatcaaggccgtggacaagg
gtctgaagaagattatgagtaagatgggtatcagcaccatccgcagctaccgcggtgcca
agatctttgagagcatcggactgagcgaggatctgctgcgccgctacttcggtaccgagg
tgagcaccattggtggtgtaggcctgaaggagatagcccgtgatgccattgcgctgcacg
aggctgccaaggagcagacactgctgcagaaccagggccagtttgcatggcgtaaggatg
gtattaagcacgcctggaaccccgagaccatcgctaagctgcagttggctacccgtcagg
gtaactacgaaaagttcaagcagtggtcgaagctggtggatgagaaggagagccccatct
ttatccgcgacttcttcggattcaagaaggctgctaagccaaccccaatcgacgaggttg
agagcgtagaaagcattgttaagcattttgttacaggtgctatgagtttcggtgccctga
gcatcgaggcccacgaggcactggcactggccatgaacaagctgggcgcccgcagtaaca
ccggtgagggtggtgaggacaacgcccgctaccactcggaggttgacggtgtaagcttga
gctcgaagaccaagcagattgccagtggacgtttcggtgtaaccgccgagtacctggtga
atgccgaggagatacagattaaggtggcacaaggagcaaaacctggtgagggcggacagc
tgcctggctttaaggttaacgagattatcgccaagacacgtaacgccatccccggtatct
cgctcatctcgcctccaccacatcacgatatctacagtatcgaggacctggcacagctta
tcttcgacctgaagaatatcaaccccacagctgccgtcagcgtaaaactggtggccgaga
gcggtgtaggaaccattgccgctggtgtggcaaaggccaaggccgatctgattgttatca
gtggtgccgagggtggtacaggtgccagccctgcttcaagtatgcgatttgcaggtatta
gtcctgagatcggactggccgagacccagcagacactggtgatgaacggcctgcgtaacc
aggttcgcctgcagaccgacggacagctgaagactgccaaggacgtgataatcatggcta
tgcttggtgccgacgagttctcgttcggaacactgcccctgattgttctgggctgtgtga
tgatgcgtaagtgtaataccaatacctgccccatgggtgtggctacccagaaccccgagc
tgcgtaagcattttgagggtagagccgagtacgtggttaacttctttaccttcctggccg
agcaggtgcgcgaatacctgagtgaaatcggcgtgaagagtctgaaggagattatcggac
acaccgaactgattgaggtgaacaccgagaacgctaccgacaagcagaagaccatcgact
ttgcacgcttgctgcacaagcctgcaaccgacaaggctctgtactgggatcgcggtgcct
acaccaaggtgacaggcgtgaaggacgaggagatgattaaggctgcacagaaggccatcg
agaaccaggaagaggtaacactcgactatgccatcaagaataccgaccgtgccgtgggta
ccatgctgagtggtgtgattgcccagaagtacggcgaggaaggactgcccgacggaacta
tcaaaattaagttcaagggctcggctggtcagagtttcggtgcctttgccgtgaagggac
tggatttgcgcctcgagggtgagaccaacgactactttggtaagggcctttcgggtggtc
gcatctctattctgcctccagctcgccgcagcgacgactttaaggctgaagaaaatatta
tcgcaggtaacaccggactttacggtgctacatcgggcgaactctatataaatggtaagg
taggcgagcgcttcggagtgcgtaactcgggtgccatcgctgtgattgaaggtgccggcg
accactgctgcgagtacatgactggcggacgtgtggtagtgctgggtaagacaggccgaa
actttgctgccggtatgagtggtggcgtggcctatgtttacgaccccgatcacacattcg
actacttctgcaacatggatatggttgaactctcgctggttgaggacagcgtatcgcgca
aagaactgttggagctgattcgtgagcactatctgcacacaggctcggccctggcaggac
gtatgctcgacgactggcaccgctacatcgaggactttatccaggttgtgcctatcgagt
acaaacgcgtgctcgaagaagagaagatggcgcgcctgcacgagaagattgccgacatcc
agcgcgactattagtaaaatgtaaaaattagaaaatgtaataatgtaaaagttgtcgcat
ttcatttttaaatttttaaattcttaaatttttaaattttacacaatgggaaatccaaaa
gcatttttagagatacaccgccaggaggcgggttaccgtccgattcacgatagaatccac
gattttggcgaggtagagcagacgctcagcactcgcgaacgcaaactgcaggccagccgc
tgtatggattgcggcgtgcccttctgccactgggcctgtccgctgggcaacaaagcaccc
gagtggaacgacgccctgtacaaaggcgactttgagttggcctatcagttgctgaacacc
accaaccccttccccgagttcacaggtcgtatctgtcctgcactgtgcgagaaggcttgc
gtgctgaaccgctttaaccacgagccaaccaccaaccgtgaggacgaggctgccatcacc
gagatggcatttcaggagggctttatccagccta


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
19 fig|264731.4.peg.1905 Glutamate synthase [NADPH] small chain (EC 1.4.1.13)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search