The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|257314.6.peg.318: Lactobacillus johnsonii NCC 533

This feature in The SEED Viewer

NCBI Taxonomy Id: 257314

Current Assignment: Lj965 prophage antirepressor
Translate Function Assignments



Context on contig NC_005362 from base 332972 to 344217 (11246 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
308 332972 333721 750 +           Phage antirepressor protein locus|LJ0295, protein_id|NP_964313.1, gi|42518383, geneID|2742431
309 333796 334011 216 + 74         Lj965 prophage protein with HTH domain locus|LJ0296, protein_id|NP_964314.1, gi|42518384, geneID|2741967
310 333989 334120 132 + -23         hypothetical protein  
311 334136 334345 210 + 15         Lj928 prophage protein locus|LJ1452b, protein_id|NP_964315.1, gi|42518385, geneID|2742278
312 334860 335225 366 + 514         Lj965 prophage protein locus|LJ0297, protein_id|NP_964317.1, gi|42518387, geneID|2742534
313 335237 336136 900 + 11         Lj928 prophage replication protein locus|LJ0298, protein_id|NP_964318.1, gi|42518388, geneID|2743027
314 336139 336975 837 + 2 4     Lj965 prophage replication protein locus|LJ0299, protein_id|NP_964319.1, gi|42518389, geneID|2742891
315 336985 337719 735 + 9 5     putative replication protein locus|LJ0300, protein_id|NP_964320.1, gi|42518390, geneID|2742007
316 337751 337993 243 + 31         Lj965 prophage protein locus|LJ0301, protein_id|NP_964321.1, gi|42518391, geneID|2742324
317 337983 338132 150 + -11         hypothetical protein  
318 338129 338965 837 + -4       Lj965 prophage antirepressor locus|LJ0302, protein_id|NP_964322.1, gi|42518392, geneID|2743306
319 338979 339164 186 + 13         hypothetical protein  
320 339204 339329 126 + 39         hypothetical protein  
321 339351 339842 492 + 21         Lj965 prophage protein locus|LJ0303, protein_id|NP_964323.1, gi|42518393, geneID|2741857
rna.9 340597 340667 71 + 754         tRNA-Ser-TGA  
rna.10 340727 340798 72 + 59         tRNA-Glu-TTC  
rna.11 340937 341018 82 + 138         tRNA-Tyr-GTA  
rna.12 341099 341172 74 + 80     1: 1   tRNA-Phe-GAA  
322 341279 342334 1056 + 106         hypothetical protein locus|LJ0304, protein_id|NP_964324.1, gi|42518394, geneID|2743264
323 342312 342692 381 + -23         Lj965 prophage protein locus|LJ0305, protein_id|NP_964325.1, gi|42518395, geneID|2742958
324 342720 343310 591 + 27         Lj965 prophage protein locus|LJ0306, protein_id|NP_964326.1, gi|42518396, geneID|2742567
325 343363 344217 855 + 52         Phage terminase, small subunit locus|LJ0307, protein_id|NP_964327.1, gi|42518397, geneID|2742256

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|257314.6.peg.318 Lj965 prophage antirepressor
MKMNNELQLFDFENNQIRVLKINNEPWFVGKDLANVLGYSNTQKAIRDHIDPDDLRGERI
VTPSGKQMTIITNESGMYSLILSSKLPSAKKFKRWVTSEVLPAIREDGAYITDNKAMQLM
SDPQELGNFLLTIGNRVKALEAEKKELKDTNAKQAAKIARDADDVVFAKAIRYSHHAIPV
GELAEILTQNGFVIGRNQLFQLLREEKYLSSFNHSWNVPMTQMVKRGLFRITHNLTRDGR
GYSQTWVTPKGQKHIINKALRGRFDDTYQKVMVSTLNV

MD5 = 4e2481ab6ef0fdbd495e90e4183fe53a


  DNA Sequence

>fig|257314.6.peg.318 Lj965 prophage antirepressor
atgaagatgaataacgaattacagctattcgactttgaaaacaatcaaattagagtttta
aaaatcaacaatgagccatggtttgttggaaaagatttagcaaatgttcttggatattct
aatactcaaaaagcgattagagatcacattgatccagacgatttaaggggtgaacgaatc
gttaccccctctggaaaacaaatgacaattattactaatgaatctggaatgtacagttta
attctttctagtaaattgccaagcgcaaagaagtttaagcgttgggtaacaagcgaagtg
cttccagcaattcgagaagatggagcatatattactgacaataaggctatgcaattgatg
agcgatcctcaggagcttggcaatttcttgttaactattggcaatagagttaaggcatta
gaagctgagaaaaaagagcttaaagacaccaatgcaaaacaagcagcaaagattgctaga
gatgctgatgatgtggtttttgctaaggctattaggtatagccatcatgcaattcctgtt
ggcgaattagctgaaattttaactcaaaacggttttgtgattggaagaaatcaactattc
caattacttagagaagaaaaatatctttcaagttttaatcatagctggaacgtgcctatg
acacagatggttaaaagagggctatttagaattactcataatttgaccagagatggcaga
ggatattctcaaacatgggtaacgcctaaaggtcagaaacacattattaacaaagcgtta
agaggaagatttgatgatacttatcaaaaagttatggtatcaactttgaacgtttag


  DNA with Flanking Sequence

>fig|257314.6.peg.318 Lj965 prophage antirepressor
aaagaccgttgtttacggtgaacagtatccacaaggttacctgcttacttgcatcaagaa
cttaccggaggaagtagtaaatgaaaaatagacttaaagagttagattggagttctaaga
taatgaaacaaaataataaaaaagataatccctgtaaattttgtaatatcaacgacgata
actatggtaaggacttttccgaagacgaatatgctgaatttaaattgtatagagtgaagg
atgattattacatctataattattcagcttatagcgatcctacttctgactggtttgaaa
catattctggaaagattaattattgtcctaaatgcggaaggaagttagctgaaaatgaaa
attaaatcaattattgaaacaactaaatgtatgtatgcagtatcaaatgatgtagatact
atttcagtttctgcagggatggaaaagtacagacaaagaatttataaaggcacaacttcc
aaacatttttggagaggacgatgaagatgaataacgaattacagctattcgactttgaaa
acaatcaaattagagttttaaaaatcaacaatgagccatggtttgttggaaaagatttag
caaatgttcttggatattctaatactcaaaaagcgattagagatcacattgatccagacg
atttaaggggtgaacgaatcgttaccccctctggaaaacaaatgacaattattactaatg
aatctggaatgtacagtttaattctttctagtaaattgccaagcgcaaagaagtttaagc
gttgggtaacaagcgaagtgcttccagcaattcgagaagatggagcatatattactgaca
ataaggctatgcaattgatgagcgatcctcaggagcttggcaatttcttgttaactattg
gcaatagagttaaggcattagaagctgagaaaaaagagcttaaagacaccaatgcaaaac
aagcagcaaagattgctagagatgctgatgatgtggtttttgctaaggctattaggtata
gccatcatgcaattcctgttggcgaattagctgaaattttaactcaaaacggttttgtga
ttggaagaaatcaactattccaattacttagagaagaaaaatatctttcaagttttaatc
atagctggaacgtgcctatgacacagatggttaaaagagggctatttagaattactcata
atttgaccagagatggcagaggatattctcaaacatgggtaacgcctaaaggtcagaaac
acattattaacaaagcgttaagaggaagatttgatgatacttatcaaaaagttatggtat
caactttgaacgtttagtgaggttagaaaaatgagcgaaattgaaaacgtaaaaaacgga
ttaacttatcttttagatattaatgatttagcaactagtgtgacagtaacagagggtggc
gaatcgcatacgatgaatttaaaagatttaaaagtgacaaataccgatgttcttttacaa
attgctgatttattaggtattgatatcaacaattaggaggagactagaaacgaattagag
gtaggcaacgaaacaatggtcatgatgtacttaaatattttgaaatatgctaagcatcat
tgttctgacaacgaagatccttatgaaattactgaccgagtatttactgatgcgttagta
gcaaataataaaaacaattagaagacgagagggagtgtaagtgtggttcagatgaattta
gggctaatgcctgataaaaaattgactgctaagaacgtaaaaagatttttggtggttgat
tttcagcaatatttagacttagcgggtatgcatcgta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT01LJ0321 Lactobacillus johnsonii NCC 533     anti-repressor (Bacteriophage A118) homolog lin0080
fig|257314.1.peg.308 Lactobacillus johnsonii NCC 533 FIG   Lj965 prophage antirepressor
gb|AAR27450.1 Lactobacillus johnsonii prophage Lj965     putative antirepressor
gb|AAS08288.1 Lactobacillus johnsonii prophage Lj965     Lj965 prophage antirepressor
gi|38731504 Lactobacillus johnsonii prophage Lj965 NCBI   putative antirepressor
gi|41179234 Lactobacillus prophage Lj965 NCBI   putative antirepressor
gi|41582677 Lactobacillus johnsonii prophage Lj965 NCBI   Lj965 prophage antirepressor
gi|42518392 Lactobacillus johnsonii NCC 533 NCBI   Lj965 prophage antirepressor
img|637479110 Lactobacillus johnsonii NCC 533 IMG   Lj965 prophage antirepressor
img|638305446 Lactobacillus johnsonii prophage Lj965 IMG   putative antirepressor
kegg|ljo:LJ0302 Lactobacillus johnsonii NCC 533 KEGG   Lj965 prophage antirepressor
ref|NP_958573.1 Lactobacillus prophage Lj965 RefSeq   putative antirepressor
ref|NP_964322.1 Lactobacillus johnsonii NCC 533 RefSeq   Lj965 prophage antirepressor
tr|Q65PV1 Lactobacillus johnsonii TrEMBL   Lj965 prophage antirepressor
tr|Q6SE90 Lactobacillus prophage Lj965 TrEMBL   Putative antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|257314.6.peg.314 Lj965 prophage replication protein
5 fig|257314.6.peg.315 putative replication protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search