The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|257309.4.peg.188: Corynebacterium diphtheriae NCTC 13129

This feature in The SEED Viewer

NCBI Taxonomy Id: 257309

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_002935 from base 160942 to 171973 (11032 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
180 160942 161760 819 +           Phage antirepressor protein locus|DIP0190, protein_id|NP_938582.1, gi|38232815, geneID|2650683
181 161977 162219 243 + 216         hypothetical protein locus|DIP0191, protein_id|NP_938583.1, gi|38232816, geneID|2650684
182 162231 162455 225 + 11         hypothetical protein locus|DIP0192, protein_id|NP_938584.1, gi|38232817, geneID|2650685
183 162452 162598 147 + -4         hypothetical protein locus|DIP0193, protein_id|NP_938585.1, gi|38232818, geneID|2650686
184 162868 163017 150 + 269         hypothetical protein locus|DIP0195, protein_id|NP_938587.1, gi|38232820, geneID|2650688
185 163569 163715 147 + 551         hypothetical protein locus|DIP0197, protein_id|NP_938589.1, gi|38232822, geneID|2650472
186 164151 165359 1209 + 435         hypothetical protein locus|DIP0198, protein_id|NP_938591.1, gi|38232824, geneID|2650474
187 165604 165966 363 + 244         hypothetical protein locus|DIP0199, protein_id|NP_938592.1, gi|38232825, geneID|2650475
188 166488 166832 345 + 521         hypothetical protein  
189 166822 168423 1602 + -11         hypothetical protein  
190 168436 169686 1251 + 12         hypothetical protein locus|DIP0203, protein_id|NP_938594.1, gi|38232827, geneID|2650478
191 169683 170726 1044 + -4         Phage capsid and scaffold locus|DIP0204, protein_id|NP_938595.1, gi|38232828, geneID|2650479
192 170723 171973 1251 + -4         Phage major capsid protein # Fam0024 locus|DIP0205, protein_id|NP_938596.1, gi|38232829, geneID|2650480

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|257309.4.peg.188 hypothetical protein
MATNSRRVGELEQAFCDSIAALEADGIAVPEKYSAVVMLGRLYAFNIDESVNTDTEQATK
ALYLGPHLMGVMKLLGTAPTEASGEDKSSAPSNVVADRMKVLEIMKEYKKQNGG

MD5 = 7766c159596f262d5c557abd7897271d


  DNA Sequence

>fig|257309.4.peg.188 hypothetical protein
ttggctactaattcgcgccgggtaggcgaactggagcaagcattttgtgattcgatcgct
gcgttggaggcagacggcattgcggtgccggaaaagtattcagcagtggtgatgctcgga
agactctacgcattcaacattgacgaatccgtgaacaccgacaccgagcaagctaccaaa
gcgctgtacctaggtccgcacttgatgggcgtcatgaagctgcttggcacggctccaaca
gaggcaagcggggaggataaatccagcgcaccatccaacgttgtcgctgatcgaatgaag
gtgctcgaaatcatgaaggagtacaagaagcaaaatgggggctaa


  DNA with Flanking Sequence

>fig|257309.4.peg.188 hypothetical protein
gaccacaacaatgtggctgggccctttgtcatgcatcaacgatgcaacacgaggggagga
caagacatggggtttgactctagagctgcgaaaaaactcaaagcaatgttcaaacaacaa
tgccgtgatgcaggtgccgtgtgctggctctgcggacaacccatcaactacgatgcccca
ccgaacagcagagactcattcgagccggatcacttctacccgcaggcaacgcacccagag
ctggcagaagacccagagaatcttcgaccatcgcactgctcctgcaacagatcccgtaaa
gacggagtaccagcccccagcctcgggagcctatccgagcaatggtgagcaaacaccagc
tagggagggggtatcaagatcacgggaacgaaatccacggacgggtgaagggtgggtcag
ctggcctctctccccgcagataccccccttacctcgaccctcaataacacggtgaaccca
acgatcggaggttgaagtcattggctactaattcgcgccgggtaggcgaactggagcaag
cattttgtgattcgatcgctgcgttggaggcagacggcattgcggtgccggaaaagtatt
cagcagtggtgatgctcggaagactctacgcattcaacattgacgaatccgtgaacaccg
acaccgagcaagctaccaaagcgctgtacctaggtccgcacttgatgggcgtcatgaagc
tgcttggcacggctccaacagaggcaagcggggaggataaatccagcgcaccatccaacg
ttgtcgctgatcgaatgaaggtgctcgaaatcatgaaggagtacaagaagcaaaatgggg
gctaaaggaaaaacggaaccacggtttttccctccaccgcttcgtgagctgacttcagaa
acgtcagcgggattcgaggtcatcgaatttgcaaagcttcttggcatcgagttgtacccg
ttccagaaatgggcgctgatccatggcctagagcttctcgaagatggttcattccgttgg
cgagtcgtcgttattgaggtcgccaggcaaaacggtaagaccatgctgatggttgttctc
ggcctctggagaatcttccaatatggagcatctcgcgtgctttctgccgcgcaatcgctc
agcgatgccgaagacacattgaacgaagcatttctaatcgcagcgtggaaccccgtgctg
cgaacattcctgccagacaatccgcgaagtgagggagaagatgacaaattcaatggcgcg
tggcgaccccgcgcaaacggcaaagcttcgatgaagctggcatcagcacctgtccctggg
atcttggacgttgcaaaaaccatgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01CD0206 Corynebacterium diphtheriae NCTC13129     hypothetical protein
fig|257309.1.peg.2283 Corynebacterium diphtheriae NCTC 13129 FIG   hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search