The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|257309.4.peg.185: Corynebacterium diphtheriae NCTC 13129

This feature in The SEED Viewer

NCBI Taxonomy Id: 257309

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_002935 from base 158618 to 169686 (11069 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
175 159025 158618 408 -           hypothetical protein locus|DIP0185, protein_id|NP_938577.1, gi|38232810, geneID|2650678
176 159196 159035 162 - 9         hypothetical protein locus|DIP0186, protein_id|NP_938578.1, gi|38232811, geneID|2650679
177 159645 159881 237 + 448         Putative transcriptional regulator locus|DIP0187, protein_id|NP_938579.1, gi|38232812, geneID|2650680
178 159928 160395 468 + 46         hypothetical protein  
179 160919 160479 441 - 83         hypothetical protein  
180 160942 161760 819 + 22         Phage antirepressor protein locus|DIP0190, protein_id|NP_938582.1, gi|38232815, geneID|2650683
181 161977 162219 243 + 216         hypothetical protein locus|DIP0191, protein_id|NP_938583.1, gi|38232816, geneID|2650684
182 162231 162455 225 + 11         hypothetical protein locus|DIP0192, protein_id|NP_938584.1, gi|38232817, geneID|2650685
183 162452 162598 147 + -4         hypothetical protein locus|DIP0193, protein_id|NP_938585.1, gi|38232818, geneID|2650686
184 162868 163017 150 + 269         hypothetical protein locus|DIP0195, protein_id|NP_938587.1, gi|38232820, geneID|2650688
185 163569 163715 147 + 551         hypothetical protein locus|DIP0197, protein_id|NP_938589.1, gi|38232822, geneID|2650472
186 164151 165359 1209 + 435         hypothetical protein locus|DIP0198, protein_id|NP_938591.1, gi|38232824, geneID|2650474
187 165604 165966 363 + 244         hypothetical protein locus|DIP0199, protein_id|NP_938592.1, gi|38232825, geneID|2650475
188 166488 166832 345 + 521         hypothetical protein  
189 166822 168423 1602 + -11         hypothetical protein  
190 168436 169686 1251 + 12         hypothetical protein locus|DIP0203, protein_id|NP_938594.1, gi|38232827, geneID|2650478

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|257309.4.peg.185 hypothetical protein
MHEGTESHRLVAEATFWTLSVLNVPEALLETEKDKANIVDAAPIGGIS

MD5 = 09d19940d35b7213c3b47294f2fadeee


  DNA Sequence

>fig|257309.4.peg.185 hypothetical protein
atgcacgagggaactgaatcgcatcgacttgtggctgaggcgacattctggaccttgtca
gtactcaacgtcccagaagcactgctcgaaaccgaaaaagataaagccaatatcgtcgat
gcagcaccaatcggagggatctcatga


  DNA with Flanking Sequence

>fig|257309.4.peg.185 hypothetical protein
cggcaaaagcaattgctgggaagagcccatatgacgttgttcagatgagagtctcaccag
accgcgattatctgtatatctgcgcagttaatgccgaagcaacgctggtcgccaaagtgg
agcttctcgtcgcgaatatcagtagtgaagaagatgagatcatcacgatagataaggcaa
aaatcccagcattgatcctcgcgactgctgagaccgggaagaaatcggaagactcgcggc
ctatggcagggatctgcattcgggggaaagaagttgatttcaccgacgaaaatggggctg
ggcgcggagttgatcttacgacgattcaccggaacgattctgcagaaatcggagatcctg
tccgcacaatcattagagtcaaacaatagcttgctgaaacatcgccttgcgatgtgacgc
catcgccagctcagataacagaactagctcgggcaacgcgatacctaggaggcaatccca
cgctgagcatgcgctcgtatatgcacgagggaactgaatcgcatcgacttgtggctgagg
cgacattctggaccttgtcagtactcaacgtcccagaagcactgctcgaaaccgaaaaag
ataaagccaatatcgtcgatgcagcaccaatcggagggatctcatgaaacatattgacgc
agcgatctgtcgccaaaagacagaaggcaaaaccgcggggcctaactactgggattccca
aggcccttgagaatcaactgtagcaatgctggaacgtcacaaaatagctagaaaaaagtg
catgacctgcacacttctggccgagtgtgagaagatgctttccgattttgaaaaagaaga
actcagagtcgacggagttgtagcagggagatactgcgatgtctcacacagaaacggctc
gagtatcgatgtcttgcgacattgcaagcactgcaatgtccgattgataccgcagggtgg
cccacggggaaaagaacccagcggggctcgaaaacaccggggagaagggctctgtgcggt
ttgctatccccttttctcaagaaaacaacgctaaacacaatgactagcaaaggaaataga
ccatggcatggagcagagtcggcgacaacatcgccacacatccgctcatgtcgaggctcc
ttacctc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search