The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|257309.4.peg.180: Corynebacterium diphtheriae NCTC 13129

This feature in The SEED Viewer

NCBI Taxonomy Id: 257309

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_002935 from base 155600 to 166832 (11233 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
172 156826 155600 1227 -   4     Phage integrase locus|DIP0182, protein_id|NP_938574.1, gi|38232807, geneID|2650557
173 157948 156926 1023 - 99         Transcriptional regulator locus|DIP0183, protein_id|NP_938575.1, gi|38232808, geneID|2650558
174 158523 157960 564 - 11         hypothetical protein locus|DIP0184, protein_id|NP_938576.1, gi|38232809, geneID|2650559
175 159025 158618 408 - 94         hypothetical protein locus|DIP0185, protein_id|NP_938577.1, gi|38232810, geneID|2650678
176 159196 159035 162 - 9         hypothetical protein locus|DIP0186, protein_id|NP_938578.1, gi|38232811, geneID|2650679
177 159645 159881 237 + 448         Putative transcriptional regulator locus|DIP0187, protein_id|NP_938579.1, gi|38232812, geneID|2650680
178 159928 160395 468 + 46         hypothetical protein  
179 160919 160479 441 - 83         hypothetical protein  
180 160942 161760 819 + 22       Phage antirepressor protein locus|DIP0190, protein_id|NP_938582.1, gi|38232815, geneID|2650683
181 161977 162219 243 + 216         hypothetical protein locus|DIP0191, protein_id|NP_938583.1, gi|38232816, geneID|2650684
182 162231 162455 225 + 11         hypothetical protein locus|DIP0192, protein_id|NP_938584.1, gi|38232817, geneID|2650685
183 162452 162598 147 + -4         hypothetical protein locus|DIP0193, protein_id|NP_938585.1, gi|38232818, geneID|2650686
184 162868 163017 150 + 269         hypothetical protein locus|DIP0195, protein_id|NP_938587.1, gi|38232820, geneID|2650688
185 163569 163715 147 + 551         hypothetical protein locus|DIP0197, protein_id|NP_938589.1, gi|38232822, geneID|2650472
186 164151 165359 1209 + 435         hypothetical protein locus|DIP0198, protein_id|NP_938591.1, gi|38232824, geneID|2650474
187 165604 165966 363 + 244         hypothetical protein locus|DIP0199, protein_id|NP_938592.1, gi|38232825, geneID|2650475
188 166488 166832 345 + 521         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|257309.4.peg.180 Phage antirepressor protein
MELKPFNFRGHNVRVLVAENGEPLWVGRDVCAVLEIKNSRDALSRIDPEGVGIADTLTPG
GIQKLKVVNESGLYELLFQSRVPQAKEFRRWVTGEVLPEIRRHGMYATTATVEQMLADPT
TAIKLLEQIKQERDQRRALEVQAAIDKPKVMFADAVAEANTDILVRDLAKILRGNGIEVG
GNRLFAWLRKHKYLMDGPSHIKHTPTQKAMELGLFKIKETVVTRSDGRSSITVTPKVTGK
GQRYFVERFLDGRFDINDIKTNKNRPVAAGRK

MD5 = 953b56b2f3f51b05e4921c613e309c5a


  DNA Sequence

>fig|257309.4.peg.180 Phage antirepressor protein
atggaattaaaaccatttaatttccgtggacacaatgtacgagtcttagttgcagagaac
ggggagccgctgtgggtaggacgagatgtatgtgcagttttagagatcaaaaactctagg
gatgcactatctcgtatcgatccagagggggtcggcattgccgacacccttacaccagga
ggtatacaaaagctcaaagtcgtaaatgaatcaggattatacgaactccttttccagtct
cgcgtacctcaagcaaaagaattccgccggtgggtaaccggagaagtcctgccagaaatc
cgtcgccacggcatgtacgcgacaaccgcaacggtagagcaaatgctcgctgatccaaca
acagcaatcaaacttctggaacagattaagcaagagcgcgaccagcgccgggcgctcgag
gtgcaagctgcgattgataaaccaaaggtcatgttcgctgatgctgtcgcggaagctaac
actgacatcttggtacgtgacttagcgaagatcttgcgcggcaatggtattgaggtcggc
ggaaatcgtcttttcgcgtggcttcgaaagcacaaatacctcatggacgggccaagccac
attaagcacacaccaacacaaaaagcgatggaactcgggctgttcaaaatcaaagaaaca
gtggtgaccagatccgacggaagatcatcgatcaccgtaacaccgaaggttacgggaaaa
gggcaacgatatttcgtcgagaggttcctcgatgggcggttcgacatcaatgacatcaag
acaaataaaaaccgacctgttgcagcaggtcggaaatga


  DNA with Flanking Sequence

>fig|257309.4.peg.180 Phage antirepressor protein
gacatatcagcagcataaaggaaagaaaatgcagagtttattcaggctccgagtcaaagg
taccccgcttgttgaacttcgggtcgtcccattcgaaaaagataggttcaccatcgtcca
tgctgacgtcaaggaccctgtaaccgtacatgcggtcaccatcgaagagatccataactt
gatgacgctccttttccgtcaaacgctcaggaatctcggggtcagcaggatcgggaaaga
cgaactggacgtcgtaatcaggcttgatccacaggctcgggaaactggacgtccgaaggt
taagcggtacaccgccctcgttgagggtattcacagcgtaggagatccaggggaaagacc
agtacggcatctcgtattcgtaaccgttgatattcagcgtgaaagttttattgctcatac
gaaaagagtaatccgcaggatcaaacacgacagcagattccaccgaaaaatgaagcatct
ttctgaaaggaggaagcgagatggaattaaaaccatttaatttccgtggacacaatgtac
gagtcttagttgcagagaacggggagccgctgtgggtaggacgagatgtatgtgcagttt
tagagatcaaaaactctagggatgcactatctcgtatcgatccagagggggtcggcattg
ccgacacccttacaccaggaggtatacaaaagctcaaagtcgtaaatgaatcaggattat
acgaactccttttccagtctcgcgtacctcaagcaaaagaattccgccggtgggtaaccg
gagaagtcctgccagaaatccgtcgccacggcatgtacgcgacaaccgcaacggtagagc
aaatgctcgctgatccaacaacagcaatcaaacttctggaacagattaagcaagagcgcg
accagcgccgggcgctcgaggtgcaagctgcgattgataaaccaaaggtcatgttcgctg
atgctgtcgcggaagctaacactgacatcttggtacgtgacttagcgaagatcttgcgcg
gcaatggtattgaggtcggcggaaatcgtcttttcgcgtggcttcgaaagcacaaatacc
tcatggacgggccaagccacattaagcacacaccaacacaaaaagcgatggaactcgggc
tgttcaaaatcaaagaaacagtggtgaccagatccgacggaagatcatcgatcaccgtaa
caccgaaggttacgggaaaagggcaacgatatttcgtcgagaggttcctcgatgggcggt
tcgacatcaatgacatcaagacaaataaaaaccgacctgttgcagcaggtcggaaatgac
actcaaggaaaagcatctatgggaaacactaccacgatcgaccgatggctgtcgccatcg
caagctgcggaaatcattccatattccgcatggcaaatccggaagttctgtcgacagggg
atcctgccgcactccaaacgacctggatcaaagcagaaccgcatcatgatcaagcactca
gacctcgtcaatttcatccagcaaggagcagcagcatgacaatgcgcacttataaaaacc
cataccccgacagcgaagatgctgtcgaaatccgcttcgatcattgccgtgaagatattg
caaaagcagcacaagagtactggcgagaaatgacagaagcagaactcgatgaccttcaag
aagaaatcatgcgtgcgcttgccgtcagcgagtggcaaaacatctggcttacaagtgccg
cattcatcacagttcttgcctaccatttccacgattagaggaagaaaaaatgattctttt
agtgctcataaacatcgtc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT01CD0195 Corynebacterium diphtheriae NCTC13129     anti-repressor (Bacteriophage A118) homolog lin0080
emb|CAE48694.1 Corynebacterium diphtheriae EMBL   Putative anti-repressor protein
fig|257309.1.peg.173 Corynebacterium diphtheriae NCTC 13129 FIG   Phage antirepressor protein
gi|38199073 Corynebacterium diphtheriae NCBI   Putative anti-repressor protein
gi|38232815 Corynebacterium diphtheriae NCTC 13129 NCBI   putative anti-repressor protein
img|637117412 Corynebacterium diphtheriae NCTC 13129 IMG   Putative anti-repressor protein
kegg|cdi:DIP0190 Corynebacterium diphtheriae gravis NCTC13129 KEGG   putative anti-repressor protein
ref|NP_938582.1 Corynebacterium diphtheriae NCTC 13129 RefSeq   putative anti-repressor protein
tr|Q6NK48 Corynebacterium diphtheriae TrEMBL   Putative anti-repressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|257309.4.peg.172 Phage integrase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search