The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|257309.4.peg.175: Corynebacterium diphtheriae NCTC 13129

This feature in The SEED Viewer

NCBI Taxonomy Id: 257309

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_002935 from base 152426 to 163715 (11290 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
169 152426 154000 1575 +           Sodium-dependent anion transporter family locus|DIP0179, protein_id|NP_938571.1, gi|38232804, geneID|2648857
rna.10 154077 154152 76 + 76     1: 1   tRNA-Arg-ACG  
170 154365 154994 630 + 212         hypothetical protein locus|DIP0180, protein_id|NP_938572.1, gi|38232805, geneID|2650555
171 155099 155371 273 + 104         hypothetical protein locus|DIP0181, protein_id|NP_938573.1, gi|38232806, geneID|2650556
172 156826 155600 1227 - 228         Phage integrase locus|DIP0182, protein_id|NP_938574.1, gi|38232807, geneID|2650557
173 157948 156926 1023 - 99         Transcriptional regulator locus|DIP0183, protein_id|NP_938575.1, gi|38232808, geneID|2650558
174 158523 157960 564 - 11         hypothetical protein locus|DIP0184, protein_id|NP_938576.1, gi|38232809, geneID|2650559
175 159025 158618 408 - 94         hypothetical protein locus|DIP0185, protein_id|NP_938577.1, gi|38232810, geneID|2650678
176 159196 159035 162 - 9         hypothetical protein locus|DIP0186, protein_id|NP_938578.1, gi|38232811, geneID|2650679
177 159645 159881 237 + 448         Putative transcriptional regulator locus|DIP0187, protein_id|NP_938579.1, gi|38232812, geneID|2650680
178 159928 160395 468 + 46         hypothetical protein  
179 160919 160479 441 - 83         hypothetical protein  
180 160942 161760 819 + 22         Phage antirepressor protein locus|DIP0190, protein_id|NP_938582.1, gi|38232815, geneID|2650683
181 161977 162219 243 + 216         hypothetical protein locus|DIP0191, protein_id|NP_938583.1, gi|38232816, geneID|2650684
182 162231 162455 225 + 11         hypothetical protein locus|DIP0192, protein_id|NP_938584.1, gi|38232817, geneID|2650685
183 162452 162598 147 + -4         hypothetical protein locus|DIP0193, protein_id|NP_938585.1, gi|38232818, geneID|2650686
184 162868 163017 150 + 269         hypothetical protein locus|DIP0195, protein_id|NP_938587.1, gi|38232820, geneID|2650688
185 163569 163715 147 + 551         hypothetical protein locus|DIP0197, protein_id|NP_938589.1, gi|38232822, geneID|2650472

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|257309.4.peg.175 hypothetical protein
MSPVEAALETLAHTMGITVIETSKLGSTLNACFHPPTQTIFIKIGLDPVTRRCAIAHELG
HAHYGHNCSTPGAERQADEWAAQQLLDVGDVEAVGLECEGSAAAMAAELGVTPHLLVLWM
GMYERGRIQPEKRAC

MD5 = 7aa20e68794d77d30b843570e6d7d5bc


  DNA Sequence

>fig|257309.4.peg.175 hypothetical protein
atgagccctgtggaagcagccctcgaaacactcgcccacaccatgggcatcacagtgatc
gagacgagcaagctgggaagcaccctcaacgcttgctttcacccaccaacacaaacaatc
tttatcaaaattggcctcgacccagtcacccgccgctgcgccatcgcccacgaactagga
catgcccactacgggcataactgctcaactcccggcgcggagcggcaggctgatgagtgg
gcagcacagcagcttttggatgttggtgatgtggaggctgtagggcttgagtgtgagggt
tctgctgcggcgatggctgcagagttgggtgttacacctcatctactcgttttgtggatg
gggatgtatgagcgaggaaggattcagccggagaagagggcatgttaa


  DNA with Flanking Sequence

>fig|257309.4.peg.175 hypothetical protein
atggaacgcatcgaactctggattcgaaagaccgttggcaatgcctcagatagagagatt
ggcaagctagcgaacatcggccaatcaacactcagccgtcaacgccgcgatggcacggtt
accgttgaaacggcagtgaagatcgcacgcgcataccaggtcagcgtcgtcccagcgctg
ctcgcgctcgatgtgctgaccgagttcgatctcaaagcattttcaacgtcgagcggaatc
atggacgctagtgatgaagatctagtcgccgagattctccgacgaatgaaagccggcaag
ccgactgggcggagaaaccaatcagcgagttggacacccgtcgcaaagcaaaacgcggca
acaactcccccaccgcacccccgcatgtcactgagcctgactacgatgccatcctcgacg
gcatcaacgccggaacagagccaattgcagcgcaaaaggccaccgacccactcgaagaaa
actacacctaggagcacttcatgagccctgtggaagcagccctcgaaacactcgcccaca
ccatgggcatcacagtgatcgagacgagcaagctgggaagcaccctcaacgcttgctttc
acccaccaacacaaacaatctttatcaaaattggcctcgacccagtcacccgccgctgcg
ccatcgcccacgaactaggacatgcccactacgggcataactgctcaactcccggcgcgg
agcggcaggctgatgagtgggcagcacagcagcttttggatgttggtgatgtggaggctg
tagggcttgagtgtgagggttctgctgcggcgatggctgcagagttgggtgttacacctc
atctactcgttttgtggatggggatgtatgagcgaggaaggattcagccggagaagaggg
catgttaatgccttaatcactttctcatatgtaacaatcggtgtgatattttcgatattt
tgttaaaatatcactcgaactgttataagaaaggaatatggcatggcccacactaccggc
gaaaacctattcacaatgaagcgggtactccgcaatcttgaagctgaccatgatgcccta
cgggaggcgctggccgatggacggcgcatgcgggacttgctcccctacggcgactacatc
aaccggtaccgcaacctgacaagggatcccatggtggtagccattcacaagcaattccac
gaaagcggactcggcgggctcacgatcgacgaatccatgtttccactcagcctccgcttc
gaggacgacgatgtcaccctcgttttccgcaggccggaaggatttcgccatggaacgaac
gaggaatcatcacaaaggccgctcatcgagcgtcgatctcgcatcgtcctcttctggaaa
tatgcagagcctggaaccgacgcgctca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01CD0191 Corynebacterium diphtheriae NCTC13129     conserved hypothetical protein
emb|CAE48689.1 Corynebacterium diphtheriae EMBL   Hypothetical protein
fig|257309.1.peg.168 Corynebacterium diphtheriae NCTC 13129 FIG   hypothetical protein
gi|38199068 Corynebacterium diphtheriae NCBI   Hypothetical protein
gi|38232810 Corynebacterium diphtheriae NCTC 13129 NCBI   hypothetical protein DIP0185
img|637117407 Corynebacterium diphtheriae NCTC 13129 IMG   hypothetical protein
kegg|cdi:DIP0185 Corynebacterium diphtheriae gravis NCTC13129 KEGG   hypothetical protein
ref|NP_938577.1 Corynebacterium diphtheriae NCTC 13129 RefSeq   hypothetical protein DIP0185
tr|Q6NK53 Corynebacterium diphtheriae TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search