The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|257309.1.peg.173: Corynebacterium diphtheriae NCTC 13129

This feature in The SEED Viewer

NCBI Taxonomy Id: 257309

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_002935 from base 154102 to 190793 (36692 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
165 156826 155600 1227 -           Phage integrase DIP0182, NP_938574.1, gi|38232807, GeneID:2650557
166 157948 156926 1023 - 99         Transcriptional regulator DIP0183, NP_938575.1, gi|38232808, GeneID:2650558
167 158523 157960 564 - 11         hypothetical protein DIP0184, NP_938576.1, gi|38232809, GeneID:2650559
168 159025 158618 408 - 94         hypothetical protein DIP0185, NP_938577.1, gi|38232810, GeneID:2650678
169 159196 159035 162 - 9         hypothetical protein DIP0186, NP_938578.1, gi|38232811, GeneID:2650679
170 159639 159881 243 + 442         Transcriptional regulator DIP0187, NP_938579.1, gi|38232812, GeneID:2650680
171 160446 160120 327 - 238         hypothetical protein DIP0188, NP_938580.1, gi|38232813, GeneID:2650681
172 160470 160961 492 + 23         hypothetical protein DIP0189, NP_938581.1, gi|38232814, GeneID:2650682
173 160942 161760 819 + -20         Phage antirepressor protein DIP0190, NP_938582.1, gi|38232815, GeneID:2650683
174 161977 162219 243 + 216         hypothetical protein DIP0191, NP_938583.1, gi|38232816, GeneID:2650684
175 162231 162455 225 + 11     1: 1   hypothetical protein DIP0192, NP_938584.1, gi|38232817, GeneID:2650685
176 162452 162598 147 + -4         hypothetical protein DIP0193, NP_938585.1, gi|38232818, GeneID:2650686
177 162606 162875 270 + 7         hypothetical protein DIP0194, NP_938586.1, gi|38232819, GeneID:2650687
178 162868 163017 150 + -8         hypothetical protein DIP0195, NP_938587.1, gi|38232820, GeneID:2650688
179 163014 163457 444 + -4         hypothetical protein DIP0196, NP_938588.1, gi|38232821, GeneID:2650689
180 163482 163715 234 + 24         hypothetical protein DIP0197, NP_938589.1, gi|38232822, GeneID:2650472
181 163814 164122 309 + 98         hypothetical protein DIP0197A, NP_938590.1, gi|38232823, GeneID:2650473
182 164151 165359 1209 + 28         hypothetical protein DIP0198, NP_938591.1, gi|38232824, GeneID:2650474
183 165352 165966 615 + -8         hypothetical protein DIP0199, NP_938592.1, gi|38232825, GeneID:2650475
184 166018 166335 318 + 51         Phage protein DIP0200, NP_938593.1, gi|38232826, GeneID:2650476
2283 166488 166832 345 + 152     1: 1   hypothetical protein  
pp.1 154102 190793 36692 + -12731         Prophage 1. Evidence: 53 nt repeat confirmed by Ramy; attL: fig|257309.1.att.1; attR: fig|257309.1.att.2  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|257309.1.peg.173 Phage antirepressor protein
MELKPFNFRGHNVRVLVAENGEPLWVGRDVCAVLEIKNSRDALSRIDPEGVGIADTLTPG
GIQKLKVVNESGLYELLFQSRVPQAKEFRRWVTGEVLPEIRRHGMYATTATVEQMLADPT
TAIKLLEQIKQERDQRRALEVQAAIDKPKVMFADAVAEANTDILVRDLAKILRGNGIEVG
GNRLFAWLRKHKYLMDGPSHIKHTPTQKAMELGLFKIKETVVTRSDGRSSITVTPKVTGK
GQRYFVERFLDGRFDINDIKTNKNRPVAAGRK

MD5 = 953b56b2f3f51b05e4921c613e309c5a


  DNA Sequence

>fig|257309.1.peg.173 Phage antirepressor protein
atggaattaaaaccatttaatttccgtggacacaatgtacgagtcttagttgcagagaac
ggggagccgctgtgggtaggacgagatgtatgtgcagttttagagatcaaaaactctagg
gatgcactatctcgtatcgatccagagggggtcggcattgccgacacccttacaccagga
ggtatacaaaagctcaaagtcgtaaatgaatcaggattatacgaactccttttccagtct
cgcgtacctcaagcaaaagaattccgccggtgggtaaccggagaagtcctgccagaaatc
cgtcgccacggcatgtacgcgacaaccgcaacggtagagcaaatgctcgctgatccaaca
acagcaatcaaacttctggaacagattaagcaagagcgcgaccagcgccgggcgctcgag
gtgcaagctgcgattgataaaccaaaggtcatgttcgctgatgctgtcgcggaagctaac
actgacatcttggtacgtgacttagcgaagatcttgcgcggcaatggtattgaggtcggc
ggaaatcgtcttttcgcgtggcttcgaaagcacaaatacctcatggacgggccaagccac
attaagcacacaccaacacaaaaagcgatggaactcgggctgttcaaaatcaaagaaaca
gtggtgaccagatccgacggaagatcatcgatcaccgtaacaccgaaggttacgggaaaa
gggcaacgatatttcgtcgagaggttcctcgatgggcggttcgacatcaatgacatcaag
acaaataaaaaccgacctgttgcagcaggtcggaaatga


  DNA with Flanking Sequence

>fig|257309.1.peg.173 Phage antirepressor protein
gacatatcagcagcataaaggaaagaaaatgcagagtttattcaggctccgagtcaaagg
taccccgcttgttgaacttcgggtcgtcccattcgaaaaagataggttcaccatcgtcca
tgctgacgtcaaggaccctgtaaccgtacatgcggtcaccatcgaagagatccataactt
gatgacgctccttttccgtcaaacgctcaggaatctcggggtcagcaggatcgggaaaga
cgaactggacgtcgtaatcaggcttgatccacaggctcgggaaactggacgtccgaaggt
taagcggtacaccgccctcgttgagggtattcacagcgtaggagatccaggggaaagacc
agtacggcatctcgtattcgtaaccgttgatattcagcgtgaaagttttattgctcatac
gaaaagagtaatccgcaggatcaaacacgacagcagattccaccgaaaaatgaagcatct
ttctgaaaggaggaagcgagatggaattaaaaccatttaatttccgtggacacaatgtac
gagtcttagttgcagagaacggggagccgctgtgggtaggacgagatgtatgtgcagttt
tagagatcaaaaactctagggatgcactatctcgtatcgatccagagggggtcggcattg
ccgacacccttacaccaggaggtatacaaaagctcaaagtcgtaaatgaatcaggattat
acgaactccttttccagtctcgcgtacctcaagcaaaagaattccgccggtgggtaaccg
gagaagtcctgccagaaatccgtcgccacggcatgtacgcgacaaccgcaacggtagagc
aaatgctcgctgatccaacaacagcaatcaaacttctggaacagattaagcaagagcgcg
accagcgccgggcgctcgaggtgcaagctgcgattgataaaccaaaggtcatgttcgctg
atgctgtcgcggaagctaacactgacatcttggtacgtgacttagcgaagatcttgcgcg
gcaatggtattgaggtcggcggaaatcgtcttttcgcgtggcttcgaaagcacaaatacc
tcatggacgggccaagccacattaagcacacaccaacacaaaaagcgatggaactcgggc
tgttcaaaatcaaagaaacagtggtgaccagatccgacggaagatcatcgatcaccgtaa
caccgaaggttacgggaaaagggcaacgatatttcgtcgagaggttcctcgatgggcggt
tcgacatcaatgacatcaagacaaataaaaaccgacctgttgcagcaggtcggaaatgac
actcaaggaaaagcatctatgggaaacactaccacgatcgaccgatggctgtcgccatcg
caagctgcggaaatcattccatattccgcatggcaaatccggaagttctgtcgacagggg
atcctgccgcactccaaacgacctggatcaaagcagaaccgcatcatgatcaagcactca
gacctcgtcaatttcatccagcaaggagcagcagcatgacaatgcgcacttataaaaacc
cataccccgacagcgaagatgctgtcgaaatccgcttcgatcattgccgtgaagatattg
caaaagcagcacaagagtactggcgagaaatgacagaagcagaactcgatgaccttcaag
aagaaatcatgcgtgcgcttgccgtcagcgagtggcaaaacatctggcttacaagtgccg
cattcatcacagttcttgcctaccatttccacgattagaggaagaaaaaatgattctttt
agtgctcataaacatcgtc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT01CD0195 Corynebacterium diphtheriae NCTC13129     anti-repressor (Bacteriophage A118) homolog lin0080
emb|CAE48694.1 Corynebacterium diphtheriae EMBL   Putative anti-repressor protein
fig|257309.4.peg.180 Corynebacterium diphtheriae NCTC 13129 FIG   Phage antirepressor protein
gi|38199073 Corynebacterium diphtheriae NCBI   Putative anti-repressor protein
gi|38232815 Corynebacterium diphtheriae NCTC 13129 NCBI   putative anti-repressor protein
img|637117412 Corynebacterium diphtheriae NCTC 13129 IMG   Putative anti-repressor protein
kegg|cdi:DIP0190 Corynebacterium diphtheriae gravis NCTC13129 KEGG   putative anti-repressor protein
ref|NP_938582.1 Corynebacterium diphtheriae NCTC 13129 RefSeq   putative anti-repressor protein
tr|Q6NK48 Corynebacterium diphtheriae TrEMBL   Putative anti-repressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33416 971.800;1-144
CDD::33443 972.500;119-251
CDD::43300 967.100;125-251
IPR::IPR003497_interpro_download 80.9;12-98
IPR::IPR005039_interpro_download 175.0;124-254
isoelectric_point 10.42
molecular_weight 30611
PFAM::PF02498 979.410;12-98
PFAM::PF02498_interpro_download 80.9;12-98
PFAM::PF03374 951.190;124-254
PFAM::PF03374_interpro_download 175.0;124-254
PSORT::Cytoplasmic 8.87
PSORT_score::Cytoplasmic 8.87
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search