The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|216591.1.peg.1909: Burkholderia cenocepacia J2315

This feature in The SEED Viewer

NCBI Taxonomy Id: 216591

Current Assignment: N-acyl-L-homoserine lactone synthetase RhlL
Translate Function Assignments



Context on contig Bcep157f02.p2kA148 from base 318351 to 330088 (11738 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1900 318743 318351 393 -              
1901 318773 319153 381 + 29            
1902 319359 319937 579 + 205            
1903 320053 320388 336 + 115            
1904 320473 321117 645 + 84     16: 14 3 15 9 5 2 10 13 12 18 11 4 17 16 8 7 ff
idu(3)
idu(3)
idu(3)
GTP cyclohydrolase II (EC 3.5.4.25)  
1905 321818 321399 420 - 281     1: 6 ff
ilit(
7959018)
ilit(8370677)
isu
Prolyl endopeptidase (EC 3.4.21.26)  
1906 321860 322093 234 + 41            
1907 322086 322376 291 + -8         FIG00460146: hypothetical protein  
1908 323345 322581 765 - 204       ff FIG00453949: hypothetical protein  
1909 324042 323398 645 - 52   1: 1 cwn
ff
N-acyl-L-homoserine lactone synthetase RhlL  
1910 324648 324217 432 - 174     1: 1 ff FIG005933: hypothetical protein  
1911 324734 325453 720 + 85 6 1: 1 cwn
ff
Transcriptional regulator RhlR  
1912 326231 325497 735 - 43       ff Mg(2+) transport ATPase protein C  
7777 326203 326469 267 + -29         FIG00458294: hypothetical protein  
1913 328053 326509 1545 - 39       cwn
ff
Probable outer membrane protein  
1914 330088 328040 2049 - -14       cwn
ff
FIG027190: Putative transmembrane protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Acyl_Homoserine_Lactone_(AHL)_Autoinducer_Quorum_Sensing_ VeronikaV N-acyl-L-homoserine lactone synthetase RhlL


  Protein Sequence

>fig|216591.1.peg.1909 N-acyl-L-homoserine lactone synthetase RhlL
MHAYKSTDPRTSMQTFVHEEGRLPHELAADLGRYRRRVFVEQLGWALPSANESFERDQFD
RDDTVYVFARNADGDMCGCARLLPTTRPYLLKSLFADLVAEDMPLPQSAAVWELSRFAAT
DDEGGPGNAEWAVRPMLAAVVECAAQLGARQLIGVTFASMERLFRRIGIHAHRAGPPKQV
DGRLVVACWIDIDPQTFAALGIEPGQAARQAIAA

MD5 = f269afab99f7bdb46c815e043f6e5def


  DNA Sequence

>fig|216591.1.peg.1909 N-acyl-L-homoserine lactone synthetase RhlL
atgcacgcatacaaaagcacagatccgaggacatccatgcagaccttcgttcacgaggaa
gggcggttgccacacgaactcgcggcggatctcgggcgctatcggcgccgcgtgttcgtc
gagcagctcggttgggcgctcccgtcggcgaacgaaagtttcgagcgtgaccagttcgat
cgcgacgataccgtctacgtgttcgcgcgaaacgccgacggcgacatgtgcggatgtgcg
cgcctgctgccgacgacgcgcccgtatctgctgaagtcgctgttcgccgacctggtcgcc
gaggacatgccgctgccgcaatcggccgccgtctgggaattgtcgcgattcgcggcgacc
gacgacgaaggcggtccgggcaacgccgaatgggccgtgcggccgatgctcgcggccgtc
gtcgaatgcgcggcccagctcggggcgcggcagttgatcggcgtgacgttcgcgagcatg
gagcggctgttccgccggatcggcatacacgcgcaccgcgcaggcccgccgaagcaggta
gatgggcgtctggtggtcgcgtgctggatcgacatcgatccgcaaacgtttgctgcgcta
ggaatcgagccggggcaagccgcccggcaagctatcgccgcctga


  DNA with Flanking Sequence

>fig|216591.1.peg.1909 N-acyl-L-homoserine lactone synthetase RhlL
cgctgctggccgaactgcgcgacaacgcgatcgacgcccgcctcgccggctataccgaat
ggcatcgcacggccggtgccggcgtcgcctacgtgacggtcggctgggactggtacctcg
aacgcgcgatgggtacgttcgtgatcgcgggcggcgacgttcgcagcaacgtgatggcca
tcgacgccaagggcgccgacatcggcatgttgcgcacggccgccgcgctcgccgcacgac
tcgccgccctcgactggcccgccgcggtcgcgtcggccctgctcgggcacaacgacgcct
atcatgccggtccgacgctccagtgacaaccggccgcgcattcctctgacgattttgcaa
gactggcgctctttataagcaaaagcggcgcggttttcaatcccgttgatcaagaaaccg
ttaccacgtcccgaatggcgtctttacgccgtcaccctgtaagagttaccagttacaggc
tcctcgtgccgcgcgctgtaatgcacgcatacaaaagcacagatccgaggacatccatgc
agaccttcgttcacgaggaagggcggttgccacacgaactcgcggcggatctcgggcgct
atcggcgccgcgtgttcgtcgagcagctcggttgggcgctcccgtcggcgaacgaaagtt
tcgagcgtgaccagttcgatcgcgacgataccgtctacgtgttcgcgcgaaacgccgacg
gcgacatgtgcggatgtgcgcgcctgctgccgacgacgcgcccgtatctgctgaagtcgc
tgttcgccgacctggtcgccgaggacatgccgctgccgcaatcggccgccgtctgggaat
tgtcgcgattcgcggcgaccgacgacgaaggcggtccgggcaacgccgaatgggccgtgc
ggccgatgctcgcggccgtcgtcgaatgcgcggcccagctcggggcgcggcagttgatcg
gcgtgacgttcgcgagcatggagcggctgttccgccggatcggcatacacgcgcaccgcg
caggcccgccgaagcaggtagatgggcgtctggtggtcgcgtgctggatcgacatcgatc
cgcaaacgtttgctgcgctaggaatcgagccggggcaagccgcccggcaagctatcgccg
cctgagccggaacgcgcgtttccgtccggggcggcatcgtaacgaaggagaaccaacgtg
gaccagtctcaggtctttcgcgcgatgatgcccgggttgacgagcgccagcggcgcccgc
gtcacggtcgcctatccgtcgtttcccaggccgttgccgctcgtgcggctcgaccgccgc
gggctcgtgtttcgtgccgccggcgccgcaccgctcgtgtgcgggctgccgcgcccggca
accctgctggtcgcggacgagccgctgtgctcgctgcgcctcgtgatccgcgacatcgcc
gcgaccggcgacggccgccacgacctgacgatgcagccgtccggcgccgccggtgacgaa
ttgctgtggcacgcgttgcgcgatcgcgagccgtaccggcgaattcggcacccgctcgcg
ccggtcgatctgcccgttcccatcgacggcgaaccgcatgcggcggccggcgaaaccgct
gcgcgcccgtcgcgcagcgcggctt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|216591.1.peg.1911 Transcriptional regulator RhlR


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33702 954.400;13-202
evidence_code cwn
evidence_code ff
isoelectric_point 5.65
molecular_weight 23639
PSORT::Cytoplasmic 8.96
PSORT_score::Cytoplasmic 8.96
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search