The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|216591.1.peg.1896: Burkholderia cenocepacia J2315

This feature in The SEED Viewer

NCBI Taxonomy Id: 216591

Current Assignment: Antirepressor
Translate Function Assignments



Context on contig Bcep157f02.p2kA148 from base 309543 to 321117 (11575 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1888 309932 309543 390 -              
1889 310783 310202 582 - 269         HNH endonuclease  
1890 311021 311347 327 + 237     1: 1   hypothetical protein  
1891 311659 311378 282 - 30            
1892 311773 312675 903 + 113     1: 2   COG1801: Uncharacterized conserved protein  
1893 313431 312721 711 - 45            
1894 313485 314123 639 + 53     1: 1   hypothetical protein  
1895 314522 314157 366 - 33            
1896 315485 314688 798 - 165         Antirepressor  
7776 316282 315800 483 - 314            
1897 316527 316270 258 - -13            
1898 317889 316687 1203 - 159     3: 21 18 19   DNA primase (EC 2.7.7.-)  
1899 318162 318350 189 + 272            
1900 318743 318351 393 - 0            
1901 318773 319153 381 + 29            
1902 319359 319937 579 + 205            
1903 320053 320388 336 + 115            
1904 320473 321117 645 + 84     16: 12 4 15 9 6 3 10 14 13 20 11 5 17 16 8 7 ff
idu(3)
idu(3)
idu(3)
GTP cyclohydrolase II (EC 3.5.4.25)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|216591.1.peg.1896 Antirepressor
MNNGLLSFDHDGATIRTLTVEGEPYFVARDVAEILGYSNYRDAIARHCKGVVKHDTPTVG
GMQELTYIPERDVYRLVMRSKLPGAERFEEWVVGTVLPSIRKSGSYAVQPAFETPRTLVE
ALRLAADLEEKRAALEVENKHQAQLIEYHKPDVQFAEAMRASEDLVDIPTVAKTLSKIKP
IGPIQLARALKECGIFRKDHKENLPMQKFVNAGFFTVIPSTWTAPDGAVKTHYKVMVTGA
GLQPLTDWYVKYIETLPPTLSKKRK

MD5 = 8d1af54d80b5d3eb526b487c7592bb9f


  DNA Sequence

>fig|216591.1.peg.1896 Antirepressor
atgaacaatggcctactttcattcgatcacgatggcgcaaccattcgcacactaactgtg
gaaggcgaaccatattttgtagcccgcgatgttgccgaaatactcggttactccaactac
cgcgatgcgattgcacgtcattgtaagggcgtcgtgaaacacgacacccctaccgtggga
ggaatgcaggaactaacttacatccccgaacgtgacgtttaccgattggtgatgcgctcc
aagcttccgggcgctgaacgtttcgaagaatgggttgtaggcactgtattgccatcgatc
cgcaagagcggttcctatgcagttcaaccggctttcgaaaccccgaggacacttgtagag
gctctacggctcgcagcggaccttgaagaaaagcgtgcagcgttagaggttgagaacaag
catcaggcgcaattgatcgagtatcacaaaccggacgtgcagtttgcagaagctatgcgc
gcatctgaggacttggtagatattcctacagttgccaagacactttcaaagataaagccg
attggacctatccagcttgcgcgtgcgctgaaagaatgcggaattttccgaaaagaccat
aaagaaaatctgcctatgcagaagtttgttaatgcggggttcttcactgtgattccgtca
acttggaccgctccggacggcgcagttaaaacgcattacaaagtgatggtgacaggcgca
ggtttgcagccgctaacggattggtacgtgaagtacatcgaaactctcccgcccacactc
agcaagaagcgcaaataa


  DNA with Flanking Sequence

>fig|216591.1.peg.1896 Antirepressor
gaatcagcaatcgcgcgactgctgcgaatgacaagcttgaatcgcacggctcttatccat
gatcttcaatatgcgaagttggtcgatactgtaaccgtaactcatttgaatttagaaccc
ggaacggccggtaatacgttagaaatttcggtgaccgcccaccgcgacttgaaggaacaa
caatgacgctggcagaactcgaagccctacacacgaaacagcttggaattctgtcaacgc
ggggattacgaaattcactcgttaccgtatctcagatgatggatacatggatagagatac
aacgcttgcgcgttgagccgatttatcgacctcggagaaaacaatgattaaacgactgca
tgctcatccggtcggcaatctcgcgctatccgtcgtgatcgccgccaccctgctcgcctc
aattattgcgtgcctgccaaacctgcactaacgtgcacttagatttacagactcacaaat
tatcttagtgaagcaaaattatgaacaatggcctactttcattcgatcacgatggcgcaa
ccattcgcacactaactgtggaaggcgaaccatattttgtagcccgcgatgttgccgaaa
tactcggttactccaactaccgcgatgcgattgcacgtcattgtaagggcgtcgtgaaac
acgacacccctaccgtgggaggaatgcaggaactaacttacatccccgaacgtgacgttt
accgattggtgatgcgctccaagcttccgggcgctgaacgtttcgaagaatgggttgtag
gcactgtattgccatcgatccgcaagagcggttcctatgcagttcaaccggctttcgaaa
ccccgaggacacttgtagaggctctacggctcgcagcggaccttgaagaaaagcgtgcag
cgttagaggttgagaacaagcatcaggcgcaattgatcgagtatcacaaaccggacgtgc
agtttgcagaagctatgcgcgcatctgaggacttggtagatattcctacagttgccaaga
cactttcaaagataaagccgattggacctatccagcttgcgcgtgcgctgaaagaatgcg
gaattttccgaaaagaccataaagaaaatctgcctatgcagaagtttgttaatgcggggt
tcttcactgtgattccgtcaacttggaccgctccggacggcgcagttaaaacgcattaca
aagtgatggtgacaggcgcaggtttgcagccgctaacggattggtacgtgaagtacatcg
aaactctcccgcccacactcagcaagaagcgcaaataatgagaagcgattttacttagac
ttaatcaaaatccacatgaagaaggcgcagcaagagcaacaaacggaaaagctgcgccga
cttatccagcaacttactagctcggaagtattcgcaataatgcgcacatgttccgaacgc
ctcagatagattcacataattagatgaacagactcaaaactcatagagacattcccatga
ttaacgaaacatccttttacgccatcctccccgacgcgccagaatgggacgacctcccgc
ttgcaaccgatcctgtatccgatgacaacgaattgcgtacggacgcgctccgggacagtt
tcaagagcttccaagacggcccgtcctttaatctacatcggagcatgatgacgggcaatg
cgacgccctcaatgcttcgggacgccgtgcgccgtctgtctaacatgctcgaagtctccg
gagaggtgggcgactatcgaacagaggcggagattgtgcgaacgctcacgaacctaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
emb|CAR55739.1 Burkholderia cenocepacia J2315 EMBL   hypothetical phage protein
gi|198039768 Burkholderia cenocepacia J2315 NCBI   hypothetical phage protein
gi|206563728 Burkholderia cenocepacia J2315 NCBI   hypothetical protein BCAM1879
kegg|bcj:BCAM1879 Burkholderia cenocepacia J2315 KEGG   hypothetical protein
ref|YP_002234491.1 Burkholderia cenocepacia J2315 RefSeq   hypothetical protein BCAM1879
tr|B4EME3   TrEMBL   Hypothetical phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33416 973.100;1-167
isoelectric_point 8.93
molecular_weight 29753
PFAM::PF02498 977.340;14-98
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search