The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|216591.1.peg.1896: Burkholderia cenocepacia J2315

This feature in The SEED Viewer

NCBI Taxonomy Id: 216591

Current Assignment: Antirepressor
Translate Function Assignments



Context on contig Bcep157f02.p2kA148 from base 309543 to 321117 (11575 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1888 309932 309543 390 -              
1889 310783 310202 582 - 269         HNH endonuclease  
1890 311021 311347 327 + 237     1: 1   hypothetical protein  
1891 311659 311378 282 - 30            
1892 311773 312675 903 + 113     1: 2   COG1801: Uncharacterized conserved protein  
1893 313431 312721 711 - 45            
1894 313485 314123 639 + 53     1: 1   hypothetical protein  
1895 314522 314157 366 - 33            
1896 315485 314688 798 - 165         Antirepressor  
7776 316282 315800 483 - 314            
1897 316527 316270 258 - -13            
1898 317889 316687 1203 - 159     3: 21 18 19   DNA primase (EC 2.7.7.-)  
1899 318162 318350 189 + 272            
1900 318743 318351 393 - 0            
1901 318773 319153 381 + 29            
1902 319359 319937 579 + 205            
1903 320053 320388 336 + 115            
1904 320473 321117 645 + 84     16: 12 4 15 9 6 3 10 14 13 20 11 5 17 16 8 7 ff
idu(3)
idu(3)
idu(3)
GTP cyclohydrolase II (EC 3.5.4.25)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|216591.1.peg.1896 Antirepressor
MNNGLLSFDHDGATIRTLTVEGEPYFVARDVAEILGYSNYRDAIARHCKGVVKHDTPTVG
GMQELTYIPERDVYRLVMRSKLPGAERFEEWVVGTVLPSIRKSGSYAVQPAFETPRTLVE
ALRLAADLEEKRAALEVENKHQAQLIEYHKPDVQFAEAMRASEDLVDIPTVAKTLSKIKP
IGPIQLARALKECGIFRKDHKENLPMQKFVNAGFFTVIPSTWTAPDGAVKTHYKVMVTGA
GLQPLTDWYVKYIETLPPTLSKKRK

MD5 = 8d1af54d80b5d3eb526b487c7592bb9f


  DNA Sequence

>fig|216591.1.peg.1896 Antirepressor
atgaacaatggcctactttcattcgatcacgatggcgcaaccattcgcacactaactgtg
gaaggcgaaccatattttgtagcccgcgatgttgccgaaatactcggttactccaactac
cgcgatgcgattgcacgtcattgtaagggcgtcgtgaaacacgacacccctaccgtggga
ggaatgcaggaactaacttacatccccgaacgtgacgtttaccgattggtgatgcgctcc
aagcttccgggcgctgaacgtttcgaagaatgggttgtaggcactgtattgccatcgatc
cgcaagagcggttcctatgcagttcaaccggctttcgaaaccccgaggacacttgtagag
gctctacggctcgcagcggaccttgaagaaaagcgtgcagcgttagaggttgagaacaag
catcaggcgcaattgatcgagtatcacaaaccggacgtgcagtttgcagaagctatgcgc
gcatctgaggacttggtagatattcctacagttgccaagacactttcaaagataaagccg
attggacctatccagcttgcgcgtgcgctgaaagaatgcggaattttccgaaaagaccat
aaagaaaatctgcctatgcagaagtttgttaatgcggggttcttcactgtgattccgtca
acttggaccgctccggacggcgcagttaaaacgcattacaaagtgatggtgacaggcgca
ggtttgcagccgctaacggattggtacgtgaagtacatcgaaactctcccgcccacactc
agcaagaagcgcaaataa


  DNA with Flanking Sequence

>fig|216591.1.peg.1896 Antirepressor
gaatcagcaatcgcgcgactgctgcgaatgacaagcttgaatcgcacggctcttatccat
gatcttcaatatgcgaagttggtcgatactgtaaccgtaactcatttgaatttagaaccc
ggaacggccggtaatacgttagaaatttcggtgaccgcccaccgcgacttgaaggaacaa
caatgacgctggcagaactcgaagccctacacacgaaacagcttggaattctgtcaacgc
ggggattacgaaattcactcgttaccgtatctcagatgatggatacatggatagagatac
aacgcttgcgcgttgagccgatttatcgacctcggagaaaacaatgattaaacgactgca
tgctcatccggtcggcaatctcgcgctatccgtcgtgatcgccgccaccctgctcgcctc
aattattgcgtgcctgccaaacctgcactaacgtgcacttagatttacagactcacaaat
tatcttagtgaagcaaaattatgaacaatggcctactttcattcgatcacgatggcgcaa
ccattcgcacactaactgtggaaggcgaaccatattttgtagcccgcgatgttgccgaaa
tactcggttactccaactaccgcgatgcgattgcacgtcattgtaagggcgtcgtgaaac
acgacacccctaccgtgggaggaatgcaggaactaacttacatccccgaacgtgacgttt
accgattggtgatgcgctccaagcttccgggcgctgaacgtttcgaagaatgggttgtag
gcactgtattgccatcgatccgcaagagcggttcctatgcagttcaaccggctttcgaaa
ccccgaggacacttgtagaggctctacggctcgcagcggaccttgaagaaaagcgtgcag
cgttagaggttgagaacaagcatcaggcgcaattgatcgagtatcacaaaccggacgtgc
agtttgcagaagctatgcgcgcatctgaggacttggtagatattcctacagttgccaaga
cactttcaaagataaagccgattggacctatccagcttgcgcgtgcgctgaaagaatgcg
gaattttccgaaaagaccataaagaaaatctgcctatgcagaagtttgttaatgcggggt
tcttcactgtgattccgtcaacttggaccgctccggacggcgcagttaaaacgcattaca
aagtgatggtgacaggcgcaggtttgcagccgctaacggattggtacgtgaagtacatcg
aaactctcccgcccacactcagcaagaagcgcaaataatgagaagcgattttacttagac
ttaatcaaaatccacatgaagaaggcgcagcaagagcaacaaacggaaaagctgcgccga
cttatccagcaacttactagctcggaagtattcgcaataatgcgcacatgttccgaacgc
ctcagatagattcacataattagatgaacagactcaaaactcatagagacattcccatga
ttaacgaaacatccttttacgccatcctccccgacgcgccagaatgggacgacctcccgc
ttgcaaccgatcctgtatccgatgacaacgaattgcgtacggacgcgctccgggacagtt
tcaagagcttccaagacggcccgtcctttaatctacatcggagcatgatgacgggcaatg
cgacgccctcaatgcttcgggacgccgtgcgccgtctgtctaacatgctcgaagtctccg
gagaggtgggcgactatcgaacagaggcggagattgtgcgaacgctcacgaacctaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
emb|CAR55739.1 Burkholderia cenocepacia J2315 EMBL   hypothetical phage protein
gi|198039768 Burkholderia cenocepacia J2315 NCBI   hypothetical phage protein
gi|206563728 Burkholderia cenocepacia J2315 NCBI   hypothetical protein BCAM1879
kegg|bcj:BCAM1879 Burkholderia cenocepacia J2315 KEGG   hypothetical protein
ref|YP_002234491.1 Burkholderia cenocepacia J2315 RefSeq   hypothetical protein BCAM1879
tr|B4EME3   TrEMBL   Hypothetical phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33416 973.100;1-167
isoelectric_point 8.93
molecular_weight 29753
PFAM::PF02498 977.340;14-98
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search