The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|216591.1.peg.1890: Burkholderia cenocepacia J2315

This feature in The SEED Viewer

NCBI Taxonomy Id: 216591

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig Bcep157f02.p2kA148 from base 305221 to 316527 (11307 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1884 306336 305221 1116 -           FIG00455841: hypothetical protein  
1885 308010 306691 1320 - 354         FIG00467626: hypothetical protein  
1886 308641 307976 666 - -35         putative TerS  
1887 309488 308832 657 - 190            
1888 309932 309543 390 - 54            
1889 310783 310202 582 - 269         HNH endonuclease  
1890 311021 311347 327 + 237     1: 1   hypothetical protein  
1891 311659 311378 282 - 30            
1892 311773 312675 903 + 113     1: 2   COG1801: Uncharacterized conserved protein  
1893 313431 312721 711 - 45            
1894 313485 314123 639 + 53     1: 1   hypothetical protein  
1895 314522 314157 366 - 33            
1896 315485 314688 798 - 165         Antirepressor  
7776 316282 315800 483 - 314            
1897 316527 316270 258 - -13            

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-227321.4.peg.3751 OlgaV hypothetical protein


  Protein Sequence

>fig|216591.1.peg.1890 hypothetical protein
MSKLAELLKQQEELAARIEAAQAEARTEGLQTVATLADQLGEPFAVEVVKMLGERFNLGE
FFRTSRKRGKMVARLPAKYRHPDGRVWSGKGRAPGWLAGHEAEYLIQQ

MD5 = 69686fb7fa3ed343edeaa437c879c578


  DNA Sequence

>fig|216591.1.peg.1890 hypothetical protein
atgtcgaaactggcagaactgctgaaacagcaagaagaacttgcggcacgaattgaagcg
gcgcaggccgaagcgcggacggagggtttgcagacggtcgcgacactcgcggatcagctt
ggcgagccgttcgcggtcgaggtcgtgaagatgttgggcgagcgcttcaatctcggtgag
ttctttcgcacgtcgcgcaagcgcggcaagatggttgcccgcctgcctgcgaagtatcgg
cacccggacggccgggtttggtccggtaagggccgcgcgcccggttggctggccggtcac
gaagccgaatacttgatccagcagtaa


  DNA with Flanking Sequence

>fig|216591.1.peg.1890 hypothetical protein
gttgccaacagccaaatcacgcgtgtcacgtatggatctagtttgatggtgctgaaatga
agctgtagcctgtcgtcgcgtccctgtttggttcccgcaggctttccggcaaacttcgcg
tgccaaatcttgctaccccggatggtcttaaagtgatgtgcggggcgctgctttttccaa
ctcagaattccggtttccggatcgtaatcaaggcactcgcgcagaaaggcttcgtgtggc
ttgagtggtttaattgtcttcatagtgtttaacgtctttgtatattgatccgcgatagtc
tgcccctgagtctcacgtcttatgggggggagtaggcgtattgcttgttggatacgaggt
ctgataaagttctactcacgcgtcgcaatgcgcggcgagataaccgagcaataagcggtg
tatgcgcgaaataacccggatttccgggctaactcgaagaaaggccatatggcacaaagt
gcctaactattgaggaacctatgtcgaaactggcagaactgctgaaacagcaagaagaac
ttgcggcacgaattgaagcggcgcaggccgaagcgcggacggagggtttgcagacggtcg
cgacactcgcggatcagcttggcgagccgttcgcggtcgaggtcgtgaagatgttgggcg
agcgcttcaatctcggtgagttctttcgcacgtcgcgcaagcgcggcaagatggttgccc
gcctgcctgcgaagtatcggcacccggacggccgggtttggtccggtaagggccgcgcgc
ccggttggctggccggtcacgaagccgaatacttgatccagcagtaagacgacgccccgc
caccgtgcggggcgttttcatttcgggccgttggtgtaccgggtcggccgtgcgaattga
tgtgcgagctggtcgcaagcttccgtggtgagatcgtccagaccaattgcgcgggtccag
aacgcgcacccggcccgtggccgcgctacgacgccttcgtacgttggatgtttgcatatg
gcgtgcgacccgtcgcagaacgcgacgccgccccaatgctcgcaaacccaacaggtgcga
tcaccgatcctgtctagaaataggccgcgaccgcagccgtcgttgctcatgacgcacaac
cactgtataaatatacagtctatcgcgcgctaagatgaggctgtcaaccggaagaattgg
ggacggcgaaaatcccgcgtgtggctgtctcggcatctgagcggaggcgagcatggcgat
tctcgtaggtacggcgtcttggacggacaaaacgctgatcgagtccggagccttttaccc
tcccggc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
emb|CAR55744.1 Burkholderia cenocepacia J2315 EMBL   putative DNA-binding phage protein
fig|216591.5.peg.5666 Burkholderia cenocepacia J2315 FIG   hypothetical protein
gi|198039773 Burkholderia cenocepacia J2315 NCBI   putative DNA-binding phage protein
gi|206563733 Burkholderia cenocepacia J2315 NCBI   putative DNA-binding phage protein
kegg|bcj:BCAM1884 Burkholderia cenocepacia J2315 KEGG   putative DNA-binding phage protein
ref|YP_002234496.1 Burkholderia cenocepacia J2315 RefSeq   putative DNA-binding phage protein
tr|B4EME8   TrEMBL   Putative DNA-binding phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 10.05
molecular_weight 12093
PSORT::Cytoplasmic 8.96
PSORT_score::Cytoplasmic 8.96
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search