The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|216591.1.peg.1884: Burkholderia cenocepacia J2315

This feature in The SEED Viewer

NCBI Taxonomy Id: 216591

Current Assignment: FIG00455841: hypothetical protein
Translate Function Assignments



Context on contig Bcep157f02.p2kA148 from base 299892 to 311347 (11456 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1879 300395 299892 504 -              
1880 301499 300591 909 - 195         FIG00466415: hypothetical protein  
1881 302171 301743 429 - 243         FIG00460317: hypothetical protein  
1882 303188 302412 777 - 240            
1883 303941 303210 732 - 21         myosin-A docking protein  
1884 306336 305221 1116 - 1279         FIG00455841: hypothetical protein  
1885 308010 306691 1320 - 354         FIG00467626: hypothetical protein  
1886 308641 307976 666 - -35         putative TerS  
1887 309488 308832 657 - 190            
1888 309932 309543 390 - 54            
1889 310783 310202 582 - 269         HNH endonuclease  
1890 311021 311347 327 + 237     1: 1   hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|216591.1.peg.1884 FIG00455841: hypothetical protein
MGTLVDLGQGTFKIYDPLLTAGSMVGNISEPLARDFLTPNDPVVRDFKFTPQNSVVAFNG
TPIYLAYAQSAFGYTGRSVYYNMLPQLAAFLVSMEVDALVLKKSGVLVAKTKPVGAAANR
ASHWWQRKKASDVKRSLNGNVLAIETDEDISTLNMANTADAMTTARNNVISNIATALDAP
AVILQNDVLTNGFGEGKEDSKVIANFVERYRNEIEHIFEFMIPRIQELAWTEEWYASFVM
ANPSYASISFQSATNHWRNNFEYKWPNYLTEPDKEKREGQERIFNAYKTLYETLQAGVQN
PETRRALAQSIVDLTNNDDMAQLLPQPIDIQFTEEDFATPAPTEFRGSERVSEDLPDDEA
AGTQIASNQKV

MD5 = c8340873d3bc7cbc0e668d3cf78358f8


  DNA Sequence

>fig|216591.1.peg.1884 FIG00455841: hypothetical protein
ttgggaacgctcgtagacctcggacaagggacgttcaaaatctacgatccgctgctcacg
gccggttcgatggtcggcaacatcagcgagccgctagcgcgggacttcctgacgcccaac
gacccggttgttcgagacttcaaattcacgcctcagaactccgtcgtcgcgttcaacggc
acgccgatctacctggcctacgcccaatccgcgttcgggtacacgggccgctccgtctac
tacaacatgcttccccagctcgccgcgttcctcgtctctatggaggtggacgcgctggta
ctgaagaagtcgggcgtactggtcgccaagacgaaacccgtaggcgcagcagcaaaccgc
gcgtctcattggtggcagcgcaagaaggcgtcggacgttaagcgctccctcaacgggaac
gtcctagcgatcgagactgacgaggatatctctacgctcaacatggcgaacacggccgac
gccatgacgaccgcacgcaacaacgtcattagcaacattgctaccgccctagacgcaccg
gcagtcatcctgcaaaacgacgtgctgacaaacggattcggggaaggtaaggaagactcc
aaggttatcgcgaacttcgtagaacgctaccgtaacgagattgagcatatctttgagttc
atgattccgcgcatacaggaattggcgtggacagaagaatggtatgcctctttcgtcatg
gcgaatccgtcatatgcgtcgatcagcttccagtcagccacgaaccattggcgcaacaac
tttgaatataaatggcccaattatctgactgagcctgacaaagaaaagcgtgaaggacaa
gaacgcattttcaacgcatacaagacactctacgaaactttgcaagcgggtgtgcagaat
ccagaaaccagacgtgcattggctcagtcgattgttgacctgacgaacaatgacgatatg
gcgcagcttctgccgcagcctattgatattcaattcacagaggaagactttgcgacgcct
gcaccaacggaattccgtggttcagaacgcgtatcagaggacttgcccgacgacgaagcc
gcagggacgcagatagcttcaaatcagaaggtataa


  DNA with Flanking Sequence

>fig|216591.1.peg.1884 FIG00455841: hypothetical protein
aatcgaaaaatcacgcacttaagcaaattctttcttaccgcattggcgacaaggaagcgt
acaaacgcgccgatgatttggccgactgcttcgcatattccgtgattcaaaccctcgtcc
ctgaattatccaataaaaataattaaggacattttatgtctgcaccatcattcgctgctg
cggatactcaggcgtccggccagcccgacaattgcgttgatgggtttgagcctcaacgta
atacgcagctatacaacaacctcgtcaacgaggttatcgagccgggtacgggcctctcct
accaactggcaaagcaaatctaccttgagcaccctatggggcagcgcgcggtagataacg
tcatcaatctggcattcagccaagagcgcactatctccggtgtccctgaggacgcgaaga
aggcgtttaagagcgcgtgggccgctgcacgggcagacaccgccatcaagaattgcgcgc
gtcacgcacgtatctacggcttgggaacgctcgtagacctcggacaagggacgttcaaaa
tctacgatccgctgctcacggccggttcgatggtcggcaacatcagcgagccgctagcgc
gggacttcctgacgcccaacgacccggttgttcgagacttcaaattcacgcctcagaact
ccgtcgtcgcgttcaacggcacgccgatctacctggcctacgcccaatccgcgttcgggt
acacgggccgctccgtctactacaacatgcttccccagctcgccgcgttcctcgtctcta
tggaggtggacgcgctggtactgaagaagtcgggcgtactggtcgccaagacgaaacccg
taggcgcagcagcaaaccgcgcgtctcattggtggcagcgcaagaaggcgtcggacgtta
agcgctccctcaacgggaacgtcctagcgatcgagactgacgaggatatctctacgctca
acatggcgaacacggccgacgccatgacgaccgcacgcaacaacgtcattagcaacattg
ctaccgccctagacgcaccggcagtcatcctgcaaaacgacgtgctgacaaacggattcg
gggaaggtaaggaagactccaaggttatcgcgaacttcgtagaacgctaccgtaacgaga
ttgagcatatctttgagttcatgattccgcgcatacaggaattggcgtggacagaagaat
ggtatgcctctttcgtcatggcgaatccgtcatatgcgtcgatcagcttccagtcagcca
cgaaccattggcgcaacaactttgaatataaatggcccaattatctgactgagcctgaca
aagaaaagcgtgaaggacaagaacgcattttcaacgcatacaagacactctacgaaactt
tgcaagcgggtgtgcagaatccagaaaccagacgtgcattggctcagtcgattgttgacc
tgacgaacaatgacgatatggcgcagcttctgccgcagcctattgatattcaattcacag
aggaagactttgcgacgcctgcaccaacggaattccgtggttcagaacgcgtatcagagg
acttgcccgacgacgaagccgcagggacgcagatagcttcaaatcagaaggtataaatta
tggcgtggaaatccacaatcacaaatattatgaaacagtttgcggatagtccacgctcca
ccaacgacctcgcccttgctgtttcccaaatacgtgaactactcaagcaatcccccgacg
acgcaatagaaatacaagagcgcgttcgggccacactgaaaaagattcacgataaagagc
taaaaaatcaacctccctcacccactggaacattcgcccgtgcacgcgtagctcagtcag
cacagcaattactagacgagaaaatcgtacagtcactgtcgctcatcgaactcaaccgca
caaagtctgtagaaacgaccgtacaacggttcgtaggttgggcgtcatccctgcctccta
aactcactgtagaccatcctcgacaggtcattgagaaggtcgaaaaaggcttcagaatcg
ttgaaaaaagcccgcttgagattaaaagagagcaagaaaggctacgtgaagcgggtataa
accggaaggtcaagac


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 4.50
molecular_weight 41409
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search