The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.564: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_004116 from base 565607 to 576353 (10747 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
555 565607 566467 861 +           DNA replication protein dnaD locus|SAG0559, protein_id|NP_687588.1, gi|22536737, geneID|1013363
556 566448 566681 234 + -20         hypothetical protein locus|SAG0560, protein_id|NP_687589.1, gi|22536738, geneID|1013364
557 566678 566818 141 + -4         Phage protein locus|SAG0561, protein_id|NP_687590.1, gi|22536739, geneID|1013365
558 566829 567083 255 + 10         hypothetical protein - phage associated locus|SAG0562, protein_id|NP_687591.1, gi|22536740, geneID|1013366
559 567086 567247 162 + 2         hypothetical protein locus|SAG0563, protein_id|NP_687592.1, gi|22536741, geneID|1013367
560 567249 567731 483 + 1         hypothetical protein (phage associated) locus|SAG0564, protein_id|NP_687593.1, gi|22536742, geneID|1013368
561 567732 568406 675 + 0         Phage single-strand DNA binding protein locus|SAG0565, protein_id|NP_687594.1, gi|22536743, geneID|1013369
562 568399 568815 417 + -8     3: 1 3 2   Single-stranded DNA-binding protein gene_name|ssb-2, locus|SAG0566, protein_id|NP_687595.1, gi|22536744, geneID|1013370
563 569396 570715 1320 + 580         Retron-type RNA-directed DNA polymerase (EC 2.7.7.49) locus|SAG0567, protein_id|NP_687596.1, gi|22536745, geneID|1013371
564 570841 571044 204 + 125         hypothetical protein locus|SAG0568, protein_id|NP_687597.1, gi|22536746, geneID|1013372
565 571223 571510 288 + 178         Phage Holliday junction resolvase locus|SAG0569, protein_id|NP_687598.1, gi|22536747, geneID|1013373
566 571701 571847 147 + 190         hypothetical protein locus|SAG0570, protein_id|NP_687599.1, gi|22536748, geneID|1013374
567 571844 572161 318 + -4         hypothetical phage protein  
568 572165 572296 132 + 3         hypothetical protein locus|SAG0571, protein_id|NP_687600.1, gi|22536749, geneID|1013375
569 572296 572712 417 + -1         conserved hypothetical protein - phage associated locus|SAG0572, protein_id|NP_687601.1, gi|22536750, geneID|1013376
570 572709 572873 165 + -4         hypothetical protein locus|SAG0573, protein_id|NP_687602.1, gi|22536751, geneID|1013377
571 572870 573139 270 + -4         Phage protein locus|SAG0574, protein_id|NP_687603.1, gi|22536752, geneID|1013378
572 573142 573474 333 + 2         hypothetical protein locus|SAG0575, protein_id|NP_687604.1, gi|22536753, geneID|1013379
573 573557 573688 132 + 82         hypothetical protein locus|SAG0576, protein_id|NP_687605.1, gi|22536754, geneID|1013380
574 573781 574314 534 + 92         Phage protein locus|SAG0577, protein_id|NP_687606.1, gi|22536755, geneID|1013381
575 574311 574577 267 + -4         hypothetical protein locus|SAG0578, protein_id|NP_687607.1, gi|22536756, geneID|1013382
576 574965 575393 429 + 387         FIG021474: Phage protein locus|SAG0579, protein_id|NP_687608.1, gi|22536757, geneID|1013383
577 575934 576353 420 + 540         Phage-associated HNH homing endonuclease  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|208435.3.peg.564 hypothetical protein
MTKPRKQRIYAIYDDDKFVDVGTKEELSARLGIKKATIEQYMTKSYQALASSKRIALLVG
IEEEYDF

MD5 = 90adc5922ac0583081dac5d1052deb0a


  DNA Sequence

>fig|208435.3.peg.564 hypothetical protein
atgacgaagccgaggaaacaaaggatatatgcaatatatgatgacgacaaatttgtcgac
gttggcacaaaagaagagttatcggcacggcttggaattaaaaaagcaacaatagaacag
tacatgactaaatcatatcaagcgttagctagctcaaaacgaattgcattgttggtaggg
attgaagaggaatatgacttttaa


  DNA with Flanking Sequence

>fig|208435.3.peg.564 hypothetical protein
aaatctcacaaaagtggtaagtataaaacctactactatccttcaagaaaatctatgaaa
tcaataaaaggcaaagtaaaagatgttatccaaacaggacaacacctgaaccttcctgat
gtcatggaaagattgaatccaatgttgagaggatgggctaattatttcaaagctgggaac
tctaagcaacacttcaagagtatagataactatgtcatatataatctaacaattatgctt
agaaagaagcacaagaagtctggaaagggatggagggaacatccgccgtcatggtactat
aactactttggactggtttgtttaaggaagttgagtaccaatatcaatgatgatagtcag
agatatggtagataacttgtgaatggctataacgtcgaagaaagaagatattgggaaagc
cgtgtaagggaaaaccttacgcacggtttgacgaggggtttctgaggagatggctcaaat
cagcgacctactctacaaaaatgacgaagccgaggaaacaaaggatatatgcaatatatg
atgacgacaaatttgtcgacgttggcacaaaagaagagttatcggcacggcttggaatta
aaaaagcaacaatagaacagtacatgactaaatcatatcaagcgttagctagctcaaaac
gaattgcattgttggtagggattgaagaggaatatgacttttaagacagaatttgaaata
ccaatcgaaccaaaacctcaaactagacctaagttcagcaaatttggtacgtacgaagat
ccaaagatgaagagatggcgaaaagaggtttctggatggatagaaaaaaattatgatgga
ccgtttttcgatgattgcataaaggtagaggtaaccttttacatgaaagcccccaaaacg
ctatcaaaagagcctacacaacgttctaaaggtaaaacaatacaaatatatcagaacttc
gtgcgtgagcttatatggcacgctaagaagcctgatattgataatctgattaaagctgtt
tttgatagtatttccgatgcaggttacgacagaatacagaaatcaggtatcgtttggtca
gatgacaatatcgtatgcgatttaagagcaaagaaaaaatacagtcagaatccaagaata
aaagtgaggattgaagagattgacagatgaattaataaatcaattttacaaaatttttga
caat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SAG_0568 Streptococcus agalactiae 2603V/R     conserved hypothetical protein
fig|208435.1.peg.561 Streptococcus agalactiae 2603V/R FIG   Phage protein
gb|AAM99469.1 Streptococcus agalactiae 2603V/R     conserved hypothetical protein
gb|AE014217_24 Streptococcus agalactiae 2603V/R     conserved hypothetical protein
gi|22533589 Streptococcus agalactiae 2603V/R NCBI   conserved hypothetical protein
gi|22536746 Streptococcus agalactiae 2603V/R NCBI   hypothetical protein SAG0568
img|637315770 Streptococcus agalactiae 2603V/R IMG   hypothetical protein
kegg|sag:SAG0568 Streptococcus agalactiae 2603 (serotype V) KEGG   hypothetical protein
ref|NP_687597.1 Streptococcus agalactiae 2603V/R RefSeq   hypothetical protein SAG0568
tr|Q8E0Z7 Streptococcus agalactiae serotype V TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search