The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.560: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: hypothetical protein (phage associated)
Translate Function Assignments



Context on contig NC_004116 from base 562191 to 572873 (10683 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
546 562415 562191 225 -           hypothetical protein locus|SAG0550, protein_id|NP_687579.1, gi|22536728, geneID|1013354
547 562474 562632 159 + 58         FIG01115240: hypothetical protein locus|SAG0551, protein_id|NP_687580.1, gi|22536729, geneID|1013355
548 562662 562850 189 + 29         hypothetical protein locus|SAG0552, protein_id|NP_687581.1, gi|22536730, geneID|1013356
549 563639 562833 807 - -18         hypothetical protein locus|SAG0553, protein_id|NP_687582.1, gi|22536731, geneID|1013357
550 563691 563882 192 + 51         prophage LambdaSa1, transcriptional regulator, Cro/CI family locus|SAG0554, protein_id|NP_687583.1, gi|22536732, geneID|1013358
551 563950 564699 750 + 67         Phage antirepressor protein locus|SAG0555, protein_id|NP_687584.1, gi|22536733, geneID|1013359
552 564711 564854 144 + 11         hypothetical protein locus|SAG0556, protein_id|NP_687585.1, gi|22536734, geneID|1013360
553 565004 565234 231 + 149         hypothetical protein locus|SAG0557, protein_id|NP_687586.1, gi|22536735, geneID|1013361
554 565372 565596 225 + 137         hypothetical protein locus|SAG0558, protein_id|NP_687587.1, gi|22536736, geneID|1013362
555 565607 566467 861 + 10         DNA replication protein dnaD locus|SAG0559, protein_id|NP_687588.1, gi|22536737, geneID|1013363
556 566448 566681 234 + -20         hypothetical protein locus|SAG0560, protein_id|NP_687589.1, gi|22536738, geneID|1013364
557 566678 566818 141 + -4         Phage protein locus|SAG0561, protein_id|NP_687590.1, gi|22536739, geneID|1013365
558 566829 567083 255 + 10         hypothetical protein - phage associated locus|SAG0562, protein_id|NP_687591.1, gi|22536740, geneID|1013366
559 567086 567247 162 + 2         hypothetical protein locus|SAG0563, protein_id|NP_687592.1, gi|22536741, geneID|1013367
560 567249 567731 483 + 1         hypothetical protein (phage associated) locus|SAG0564, protein_id|NP_687593.1, gi|22536742, geneID|1013368
561 567732 568406 675 + 0         Phage single-strand DNA binding protein locus|SAG0565, protein_id|NP_687594.1, gi|22536743, geneID|1013369
562 568399 568815 417 + -8     3: 1 3 2   Single-stranded DNA-binding protein gene_name|ssb-2, locus|SAG0566, protein_id|NP_687595.1, gi|22536744, geneID|1013370
563 569396 570715 1320 + 580         Retron-type RNA-directed DNA polymerase (EC 2.7.7.49) locus|SAG0567, protein_id|NP_687596.1, gi|22536745, geneID|1013371
564 570841 571044 204 + 125         hypothetical protein locus|SAG0568, protein_id|NP_687597.1, gi|22536746, geneID|1013372
565 571223 571510 288 + 178         Phage Holliday junction resolvase locus|SAG0569, protein_id|NP_687598.1, gi|22536747, geneID|1013373
566 571701 571847 147 + 190         hypothetical protein locus|SAG0570, protein_id|NP_687599.1, gi|22536748, geneID|1013374
567 571844 572161 318 + -4         hypothetical phage protein  
568 572165 572296 132 + 3         hypothetical protein locus|SAG0571, protein_id|NP_687600.1, gi|22536749, geneID|1013375
569 572296 572712 417 + -1         conserved hypothetical protein - phage associated locus|SAG0572, protein_id|NP_687601.1, gi|22536750, geneID|1013376
570 572709 572873 165 + -4         hypothetical protein locus|SAG0573, protein_id|NP_687602.1, gi|22536751, geneID|1013377

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|208435.3.peg.560 hypothetical protein (phage associated)
MAYLYELEGIYAQLQSMDLDEETFQDTLDSIDFQSDLENNIEYFVKMLKNVQADAEKYKA
EKEAFYKKQKQAEAKAEKYKETIRLAMELSQKKKVDAGMFKVSLRRSKKVEILDETKIPL
DYMQEKIEYKPMKAEISKALKSGIDISGVELIETESLQVK

MD5 = 23a2bcee3867d58165bc6720b9adf072


  DNA Sequence

>fig|208435.3.peg.560 hypothetical protein (phage associated)
atggcttatttatacgaattagaaggtatttacgcacaattacagtcaatggatttagac
gaagaaacattccaagatacacttgacagcattgattttcagtcagacttagaaaataac
attgagtattttgtcaaaatgttaaaaaatgtgcaggctgatgctgaaaagtataaagcc
gaaaaagaagctttttataaaaagcaaaaacaagcggaagccaaagcggaaaaatacaaa
gagacgatcaggcttgcaatggaattgagtcaaaagaaaaaagttgacgctggaatgttt
aaggtgtctttgcgaagaagtaaaaaagttgagattttggacgaaacaaaaattcctctt
gattacatgcaagaaaaaattgaatacaaaccaatgaaagctgaaatctcaaaagctttg
aaatctggaattgatatatctggagttgaactaatcgaaacagaaagtttgcaggtaaag
taa


  DNA with Flanking Sequence

>fig|208435.3.peg.560 hypothetical protein (phage associated)
ttttgggctagttgataaatcacagtacgtgacactattgcggcaattgcgcaagaaata
tgcgatttaggaagggatatatggttgaaatcagaattaacggtgagtcaatcacatttg
atagcaattttagggatgcgcttatatttacggtagatcacctaaaaaattatgacgatc
cttctttgaggcagacttacaacgagtttaaagattatacagacgaggacttgatgggat
atatcagcacagaatttgatgtagacccggaaatgtttgttgatactaattcagacagca
gatggaaaattaaacaacgaattttagaggactgactgtgaacgaagaaatatatgagtc
tagtcgttactggcaaagtagatacagcgacttgatgtctgattatcttaaagaagctga
agaaaatatagagttaaagaaacagttgaagagattaaaagccgaaaattggcagctgaa
acacagaaagaggaaatgatatggcttatttatacgaattagaaggtatttacgcacaat
tacagtcaatggatttagacgaagaaacattccaagatacacttgacagcattgattttc
agtcagacttagaaaataacattgagtattttgtcaaaatgttaaaaaatgtgcaggctg
atgctgaaaagtataaagccgaaaaagaagctttttataaaaagcaaaaacaagcggaag
ccaaagcggaaaaatacaaagagacgatcaggcttgcaatggaattgagtcaaaagaaaa
aagttgacgctggaatgtttaaggtgtctttgcgaagaagtaaaaaagttgagattttgg
acgaaacaaaaattcctcttgattacatgcaagaaaaaattgaatacaaaccaatgaaag
ctgaaatctcaaaagctttgaaatctggaattgatatatctggagttgaactaatcgaaa
cagaaagtttgcaggtaaagtaaatgaggaaatcagaaagtataacagaatatgctaaag
ccttttgtaaagctcagctagaggtaaaacaaccactaaaagataaggataacccatttt
tcaaaagcaaatacgtgccgcttgaaaatgttacagaagcaatcacaacagcttttgcca
ataacgggatatctttttcgcaggacccgacaacaaacacagaaaacggttatatcgatg
ttgcaacgcttgtcatgcacacgagcggcgaatgggttgagtacgggcctttaagtgtta
aacctacaaaaaatgatgtacaaggcgctggttcggctatcacttacgcaaaacgctatg
cactatcggcaatttttgggataacaagcgatcaagatgatgacggcaacgaagatagta
aaccaaacaattccaggcaatcgccaaaagctacaactaaaaaaacacaaaagacaggat
atcaaacaccaaaaatcagcaatatccaaatcgagacttacaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SAG_0564 Streptococcus agalactiae 2603V/R     conserved hypothetical protein
fig|208435.1.peg.557 Streptococcus agalactiae 2603V/R FIG   hypothetical protein (phage associated)
gb|AAM99465.1 Streptococcus agalactiae 2603V/R     conserved hypothetical protein
gb|AE014217_20 Streptococcus agalactiae 2603V/R     conserved hypothetical protein
gi|22533585 Streptococcus agalactiae 2603V/R NCBI   conserved hypothetical protein
gi|22536742 Streptococcus agalactiae 2603V/R NCBI   hypothetical protein SAG0564
img|637315766 Streptococcus agalactiae 2603V/R IMG   hypothetical protein
kegg|sag:SAG0564 Streptococcus agalactiae 2603 (serotype V) KEGG   hypothetical protein
ref|NP_687593.1 Streptococcus agalactiae 2603V/R RefSeq   hypothetical protein SAG0564
tr|Q8E101 Streptococcus agalactiae serotype V TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search