The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.551: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: Phage antirepressor protein
Turn Off Function Translation



Context on contig NC_004116 from base 558826 to 570715 (11890 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
541 559905 558826 1080 -   8     Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  
543 560891 560334 558 - 241         hypothetical protein locus|SAG0547, protein_id|NP_687576.1, gi|22536725, geneID|1013351
544 561690 560893 798 - 1         Phage CI-like repressor locus|SAG0548, protein_id|NP_687577.1, gi|22536726, geneID|1013352
545 562051 562194 144 + 360         hypothetical protein locus|SAG0549, protein_id|NP_687578.1, gi|22536727, geneID|1013353
546 562415 562191 225 - -4         hypothetical protein locus|SAG0550, protein_id|NP_687579.1, gi|22536728, geneID|1013354
547 562474 562632 159 + 58         FIG01115240: hypothetical protein locus|SAG0551, protein_id|NP_687580.1, gi|22536729, geneID|1013355
548 562662 562850 189 + 29         hypothetical protein locus|SAG0552, protein_id|NP_687581.1, gi|22536730, geneID|1013356
549 563639 562833 807 - -18         hypothetical protein locus|SAG0553, protein_id|NP_687582.1, gi|22536731, geneID|1013357
550 563691 563882 192 + 51         prophage LambdaSa1, transcriptional regulator, Cro/CI family locus|SAG0554, protein_id|NP_687583.1, gi|22536732, geneID|1013358
551 563950 564699 750 + 67       Phage antirepressor protein locus|SAG0555, protein_id|NP_687584.1, gi|22536733, geneID|1013359
552 564711 564854 144 + 11         hypothetical protein locus|SAG0556, protein_id|NP_687585.1, gi|22536734, geneID|1013360
553 565004 565234 231 + 149         hypothetical protein locus|SAG0557, protein_id|NP_687586.1, gi|22536735, geneID|1013361
554 565372 565596 225 + 137         hypothetical protein locus|SAG0558, protein_id|NP_687587.1, gi|22536736, geneID|1013362
555 565607 566467 861 + 10 4     DNA replication protein dnaD locus|SAG0559, protein_id|NP_687588.1, gi|22536737, geneID|1013363
556 566448 566681 234 + -20         hypothetical protein locus|SAG0560, protein_id|NP_687589.1, gi|22536738, geneID|1013364
557 566678 566818 141 + -4         Phage protein locus|SAG0561, protein_id|NP_687590.1, gi|22536739, geneID|1013365
558 566829 567083 255 + 10         hypothetical protein - phage associated locus|SAG0562, protein_id|NP_687591.1, gi|22536740, geneID|1013366
559 567086 567247 162 + 2         hypothetical protein locus|SAG0563, protein_id|NP_687592.1, gi|22536741, geneID|1013367
560 567249 567731 483 + 1         hypothetical protein (phage associated) locus|SAG0564, protein_id|NP_687593.1, gi|22536742, geneID|1013368
561 567732 568406 675 + 0         Phage single-strand DNA binding protein locus|SAG0565, protein_id|NP_687594.1, gi|22536743, geneID|1013369
562 568399 568815 417 + -8 4 3: 1 3 2   Single-stranded DNA-binding protein gene_name|ssb-2, locus|SAG0566, protein_id|NP_687595.1, gi|22536744, geneID|1013370
563 569396 570715 1320 + 580         Retron-type RNA-directed DNA polymerase (EC 2.7.7.49) locus|SAG0567, protein_id|NP_687596.1, gi|22536745, geneID|1013371

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|208435.3.peg.551 Phage antirepressor protein
MNQLINITLNENQEPVVSGRDLHNVLNIKTQYTKWLERMSEYGFEENVDYIAISQKRLTA
QGNRTEYIDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQVEKDFNSPEKIMARALLMADKK
ITNLTMENNQLQLDLKEAQKQARYLDLIIESKGALRVTQIAADYGMSVNKFNKTLLEFGV
QHKVNGQWILYKRHMGKGYTDSHTFDYQDKNGHTRANVTTTWTQKGRLFLYELLKDNNIL
PLIEQEDIV

MD5 = 96382053b783811df469532548807d76


  DNA Sequence

>fig|208435.3.peg.551 Phage antirepressor protein
atgaatcaactaataaacatcaccctaaacgaaaatcaagaaccagttgtcagtggtaga
gatttacacaatgtacttaatataaaaactcaatatactaaatggcttgaaaggatgtcg
gaatatggttttgaagaaaacgttgactatatagctattagtcaaaaaagactaacagct
caaggtaaccgtacagaatatatagaccacgttctcaagctagacatggcaaaagagatt
gctatgttacagcgaaacgagaaatcaaaacaggtacgcaaatacttcatccaggttgaa
aaagacttcaatagtcctgagaaaatcatggcgagagccttgctcatggcagataagaaa
atcactaacttaacgatggaaaataatcaattgcagttagatttaaaagaagctcaaaag
caagcgcgttatcttgatctaatcattgagagcaagggagctttgcgagtaacacagatt
gctgctgattatggtatgtctgtcaataaattcaataaaacactattagaatttggtgtg
cagcacaaagtgaatggacaatggattctctataaacgacatatgggcaaaggttacaca
gacagtcacacatttgactatcaagacaaaaacggccatacaagagccaatgtgacgacg
acgtggacacaaaaggggcgtctattcctgtacgagttgttgaaagacaacaatattttg
ccactaattgaacaggaagacattgtatag


  DNA with Flanking Sequence

>fig|208435.3.peg.551 Phage antirepressor protein
taaaatcgtttctgttagtaatgtacttatttcttcgattttcagctatttcatgtaatt
tttcaaaaccaattaatgtcattaaatcatcaatagctcttgcaggattttcagctttct
ttatggcagtagttcctaagagagtagcagaaccaagcaaaatcgtctttatatcaagac
tttcaatcataatacaactccgttttttatttcaattataccacagaaagggggtggggg
aatgcaacaatttaatctaaaacaactacgagagaaaaaaggatttactcaaaatgaatt
agctgataaagctaacgttagtcgttcgctcgtggttggtttagaaacaggttcatattc
agagacatctacagcatctctgaagaaattggcgaaagctttggacgtaaagattaagga
tttatttttttaactaatcgtctaacatgatagacaaaatatttgttaataaaactaaca
aaccgctagaaaggaactatatgaatcaactaataaacatcaccctaaacgaaaatcaag
aaccagttgtcagtggtagagatttacacaatgtacttaatataaaaactcaatatacta
aatggcttgaaaggatgtcggaatatggttttgaagaaaacgttgactatatagctatta
gtcaaaaaagactaacagctcaaggtaaccgtacagaatatatagaccacgttctcaagc
tagacatggcaaaagagattgctatgttacagcgaaacgagaaatcaaaacaggtacgca
aatacttcatccaggttgaaaaagacttcaatagtcctgagaaaatcatggcgagagcct
tgctcatggcagataagaaaatcactaacttaacgatggaaaataatcaattgcagttag
atttaaaagaagctcaaaagcaagcgcgttatcttgatctaatcattgagagcaagggag
ctttgcgagtaacacagattgctgctgattatggtatgtctgtcaataaattcaataaaa
cactattagaatttggtgtgcagcacaaagtgaatggacaatggattctctataaacgac
atatgggcaaaggttacacagacagtcacacatttgactatcaagacaaaaacggccata
caagagccaatgtgacgacgacgtggacacaaaaggggcgtctattcctgtacgagttgt
tgaaagacaacaatattttgccactaattgaacaggaagacattgtatagaaaggaaaca
tatgagaccaaaacaatatccgtatagcggaaataaaaaagaatctattgcggtaacagt
agattccaaaacgctagccgagaaactagagattactgaccaatcgaatatttcccaagc
gaaacaccgattatttggtctgtaaacaagtagacaaacggcattttgaattcttgatgt
gaagatgaaatcaaggtatcagcttagacgaatttagataagaaaaaaagtccgacggga
atcggactcaaaacaaacttaatttacttaattatatcacagaaaggaaacaatatgcta
gcaaaacttaaaagcggtatcgaagtaccttacgaagagctttggcttaatgataacgac
ttatccgaatttattggaaagtcatttgaccaaacgcagcgattactaagaaagatgtac
aaagacagaaattatcgcaaatacattgacaaggttggcggtcgttcaacaaaagttaaa
aaatttgaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|SAG_0555 Streptococcus agalactiae 2603V/R     prophage LambdaSa1, antirepressor, putative
fig|208435.1.peg.548 Streptococcus agalactiae 2603V/R FIG   Phage antirepressor protein
gb|AAM99456.1 Streptococcus agalactiae 2603V/R     prophage LambdaSa1, antirepressor, putative
gb|AE014217_11 Streptococcus agalactiae 2603V/R     prophage LambdaSa1, antirepressor, putative
gi|22533576 Streptococcus agalactiae 2603V/R NCBI   prophage LambdaSa1, antirepressor, putative
gi|22536733 Streptococcus agalactiae 2603V/R NCBI   prophage LambdaSa1, antirepressor, putative
img|637315757 Streptococcus agalactiae 2603V/R IMG   prophage LambdaSa1, antirepressor, putative
kegg|sag:SAG0555 Streptococcus agalactiae 2603 (serotype V) KEGG   prophage LambdaSa1, antirepressor, putative
ref|NP_687584.1 Streptococcus agalactiae 2603V/R RefSeq   prophage LambdaSa1, antirepressor, putative
tr|Q8E110 Streptococcus agalactiae serotype V TrEMBL   Prophage LambdaSa1, antirepressor, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
8 fig|208435.3.peg.541 Integrase
4 fig|208435.3.peg.555 DNA replication protein dnaD
4 fig|208435.3.peg.562 Single-stranded DNA-binding protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search