The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.551: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_004116 from base 558826 to 570715 (11890 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
541 559905 558826 1080 -   8     Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  
543 560891 560334 558 - 241         hypothetical protein locus|SAG0547, protein_id|NP_687576.1, gi|22536725, geneID|1013351
544 561690 560893 798 - 1         Phage CI-like repressor locus|SAG0548, protein_id|NP_687577.1, gi|22536726, geneID|1013352
545 562051 562194 144 + 360         hypothetical protein locus|SAG0549, protein_id|NP_687578.1, gi|22536727, geneID|1013353
546 562415 562191 225 - -4         hypothetical protein locus|SAG0550, protein_id|NP_687579.1, gi|22536728, geneID|1013354
547 562474 562632 159 + 58         FIG01115240: hypothetical protein locus|SAG0551, protein_id|NP_687580.1, gi|22536729, geneID|1013355
548 562662 562850 189 + 29         hypothetical protein locus|SAG0552, protein_id|NP_687581.1, gi|22536730, geneID|1013356
549 563639 562833 807 - -18         hypothetical protein locus|SAG0553, protein_id|NP_687582.1, gi|22536731, geneID|1013357
550 563691 563882 192 + 51         prophage LambdaSa1, transcriptional regulator, Cro/CI family locus|SAG0554, protein_id|NP_687583.1, gi|22536732, geneID|1013358
551 563950 564699 750 + 67       Phage antirepressor protein locus|SAG0555, protein_id|NP_687584.1, gi|22536733, geneID|1013359
552 564711 564854 144 + 11         hypothetical protein locus|SAG0556, protein_id|NP_687585.1, gi|22536734, geneID|1013360
553 565004 565234 231 + 149         hypothetical protein locus|SAG0557, protein_id|NP_687586.1, gi|22536735, geneID|1013361
554 565372 565596 225 + 137         hypothetical protein locus|SAG0558, protein_id|NP_687587.1, gi|22536736, geneID|1013362
555 565607 566467 861 + 10 4     DNA replication protein dnaD locus|SAG0559, protein_id|NP_687588.1, gi|22536737, geneID|1013363
556 566448 566681 234 + -20         hypothetical protein locus|SAG0560, protein_id|NP_687589.1, gi|22536738, geneID|1013364
557 566678 566818 141 + -4         Phage protein locus|SAG0561, protein_id|NP_687590.1, gi|22536739, geneID|1013365
558 566829 567083 255 + 10         hypothetical protein - phage associated locus|SAG0562, protein_id|NP_687591.1, gi|22536740, geneID|1013366
559 567086 567247 162 + 2         hypothetical protein locus|SAG0563, protein_id|NP_687592.1, gi|22536741, geneID|1013367
560 567249 567731 483 + 1         hypothetical protein (phage associated) locus|SAG0564, protein_id|NP_687593.1, gi|22536742, geneID|1013368
561 567732 568406 675 + 0         Phage single-strand DNA binding protein locus|SAG0565, protein_id|NP_687594.1, gi|22536743, geneID|1013369
562 568399 568815 417 + -8 4 3: 1 3 2   Single-stranded DNA-binding protein gene_name|ssb-2, locus|SAG0566, protein_id|NP_687595.1, gi|22536744, geneID|1013370
563 569396 570715 1320 + 580         Retron-type RNA-directed DNA polymerase (EC 2.7.7.49) locus|SAG0567, protein_id|NP_687596.1, gi|22536745, geneID|1013371

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|208435.3.peg.551 Phage antirepressor protein
MNQLINITLNENQEPVVSGRDLHNVLNIKTQYTKWLERMSEYGFEENVDYIAISQKRLTA
QGNRTEYIDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQVEKDFNSPEKIMARALLMADKK
ITNLTMENNQLQLDLKEAQKQARYLDLIIESKGALRVTQIAADYGMSVNKFNKTLLEFGV
QHKVNGQWILYKRHMGKGYTDSHTFDYQDKNGHTRANVTTTWTQKGRLFLYELLKDNNIL
PLIEQEDIV

MD5 = 96382053b783811df469532548807d76


  DNA Sequence

>fig|208435.3.peg.551 Phage antirepressor protein
atgaatcaactaataaacatcaccctaaacgaaaatcaagaaccagttgtcagtggtaga
gatttacacaatgtacttaatataaaaactcaatatactaaatggcttgaaaggatgtcg
gaatatggttttgaagaaaacgttgactatatagctattagtcaaaaaagactaacagct
caaggtaaccgtacagaatatatagaccacgttctcaagctagacatggcaaaagagatt
gctatgttacagcgaaacgagaaatcaaaacaggtacgcaaatacttcatccaggttgaa
aaagacttcaatagtcctgagaaaatcatggcgagagccttgctcatggcagataagaaa
atcactaacttaacgatggaaaataatcaattgcagttagatttaaaagaagctcaaaag
caagcgcgttatcttgatctaatcattgagagcaagggagctttgcgagtaacacagatt
gctgctgattatggtatgtctgtcaataaattcaataaaacactattagaatttggtgtg
cagcacaaagtgaatggacaatggattctctataaacgacatatgggcaaaggttacaca
gacagtcacacatttgactatcaagacaaaaacggccatacaagagccaatgtgacgacg
acgtggacacaaaaggggcgtctattcctgtacgagttgttgaaagacaacaatattttg
ccactaattgaacaggaagacattgtatag


  DNA with Flanking Sequence

>fig|208435.3.peg.551 Phage antirepressor protein
taaaatcgtttctgttagtaatgtacttatttcttcgattttcagctatttcatgtaatt
tttcaaaaccaattaatgtcattaaatcatcaatagctcttgcaggattttcagctttct
ttatggcagtagttcctaagagagtagcagaaccaagcaaaatcgtctttatatcaagac
tttcaatcataatacaactccgttttttatttcaattataccacagaaagggggtggggg
aatgcaacaatttaatctaaaacaactacgagagaaaaaaggatttactcaaaatgaatt
agctgataaagctaacgttagtcgttcgctcgtggttggtttagaaacaggttcatattc
agagacatctacagcatctctgaagaaattggcgaaagctttggacgtaaagattaagga
tttatttttttaactaatcgtctaacatgatagacaaaatatttgttaataaaactaaca
aaccgctagaaaggaactatatgaatcaactaataaacatcaccctaaacgaaaatcaag
aaccagttgtcagtggtagagatttacacaatgtacttaatataaaaactcaatatacta
aatggcttgaaaggatgtcggaatatggttttgaagaaaacgttgactatatagctatta
gtcaaaaaagactaacagctcaaggtaaccgtacagaatatatagaccacgttctcaagc
tagacatggcaaaagagattgctatgttacagcgaaacgagaaatcaaaacaggtacgca
aatacttcatccaggttgaaaaagacttcaatagtcctgagaaaatcatggcgagagcct
tgctcatggcagataagaaaatcactaacttaacgatggaaaataatcaattgcagttag
atttaaaagaagctcaaaagcaagcgcgttatcttgatctaatcattgagagcaagggag
ctttgcgagtaacacagattgctgctgattatggtatgtctgtcaataaattcaataaaa
cactattagaatttggtgtgcagcacaaagtgaatggacaatggattctctataaacgac
atatgggcaaaggttacacagacagtcacacatttgactatcaagacaaaaacggccata
caagagccaatgtgacgacgacgtggacacaaaaggggcgtctattcctgtacgagttgt
tgaaagacaacaatattttgccactaattgaacaggaagacattgtatagaaaggaaaca
tatgagaccaaaacaatatccgtatagcggaaataaaaaagaatctattgcggtaacagt
agattccaaaacgctagccgagaaactagagattactgaccaatcgaatatttcccaagc
gaaacaccgattatttggtctgtaaacaagtagacaaacggcattttgaattcttgatgt
gaagatgaaatcaaggtatcagcttagacgaatttagataagaaaaaaagtccgacggga
atcggactcaaaacaaacttaatttacttaattatatcacagaaaggaaacaatatgcta
gcaaaacttaaaagcggtatcgaagtaccttacgaagagctttggcttaatgataacgac
ttatccgaatttattggaaagtcatttgaccaaacgcagcgattactaagaaagatgtac
aaagacagaaattatcgcaaatacattgacaaggttggcggtcgttcaacaaaagttaaa
aaatttgaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|SAG_0555 Streptococcus agalactiae 2603V/R     prophage LambdaSa1, antirepressor, putative
fig|208435.1.peg.548 Streptococcus agalactiae 2603V/R FIG   Phage antirepressor protein
gb|AAM99456.1 Streptococcus agalactiae 2603V/R     prophage LambdaSa1, antirepressor, putative
gb|AE014217_11 Streptococcus agalactiae 2603V/R     prophage LambdaSa1, antirepressor, putative
gi|22533576 Streptococcus agalactiae 2603V/R NCBI   prophage LambdaSa1, antirepressor, putative
gi|22536733 Streptococcus agalactiae 2603V/R NCBI   prophage LambdaSa1, antirepressor, putative
img|637315757 Streptococcus agalactiae 2603V/R IMG   prophage LambdaSa1, antirepressor, putative
kegg|sag:SAG0555 Streptococcus agalactiae 2603 (serotype V) KEGG   prophage LambdaSa1, antirepressor, putative
ref|NP_687584.1 Streptococcus agalactiae 2603V/R RefSeq   prophage LambdaSa1, antirepressor, putative
tr|Q8E110 Streptococcus agalactiae serotype V TrEMBL   Prophage LambdaSa1, antirepressor, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
8 fig|208435.3.peg.541 Integrase
4 fig|208435.3.peg.555 DNA replication protein dnaD
4 fig|208435.3.peg.562 Single-stranded DNA-binding protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search